Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QLX50_RS14460 Genome accession   NZ_CP125283
Coordinates   2955427..2955567 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain IFST-221     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2950427..2960567
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLX50_RS14435 (QLX50_14435) - 2950767..2951150 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  QLX50_RS14440 (QLX50_14440) comA 2951172..2951816 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  QLX50_RS14445 (QLX50_14445) comP 2951897..2954188 (-) 2292 WP_282999838.1 histidine kinase Regulator
  QLX50_RS14450 (QLX50_14450) comX 2954200..2954364 (-) 165 WP_007613432.1 competence pheromone ComX -
  QLX50_RS14455 (QLX50_14455) - 2954364..2955275 (-) 912 WP_007613433.1 polyprenyl synthetase family protein -
  QLX50_RS14460 (QLX50_14460) degQ 2955427..2955567 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QLX50_RS14465 (QLX50_14465) - 2956033..2956374 (+) 342 WP_044801746.1 hypothetical protein -
  QLX50_RS14470 (QLX50_14470) - 2956381..2957604 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  QLX50_RS14475 (QLX50_14475) - 2957734..2959200 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  QLX50_RS14480 (QLX50_14480) - 2959218..2959769 (-) 552 WP_282999842.1 isochorismatase family cysteine hydrolase -
  QLX50_RS14485 (QLX50_14485) - 2959866..2960264 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=830637 QLX50_RS14460 WP_003152043.1 2955427..2955567(-) (degQ) [Bacillus velezensis strain IFST-221]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=830637 QLX50_RS14460 WP_003152043.1 2955427..2955567(-) (degQ) [Bacillus velezensis strain IFST-221]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891