Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | QLX50_RS14460 | Genome accession | NZ_CP125283 |
| Coordinates | 2955427..2955567 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain IFST-221 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2950427..2960567
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLX50_RS14435 (QLX50_14435) | - | 2950767..2951150 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| QLX50_RS14440 (QLX50_14440) | comA | 2951172..2951816 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| QLX50_RS14445 (QLX50_14445) | comP | 2951897..2954188 (-) | 2292 | WP_282999838.1 | histidine kinase | Regulator |
| QLX50_RS14450 (QLX50_14450) | comX | 2954200..2954364 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| QLX50_RS14455 (QLX50_14455) | - | 2954364..2955275 (-) | 912 | WP_007613433.1 | polyprenyl synthetase family protein | - |
| QLX50_RS14460 (QLX50_14460) | degQ | 2955427..2955567 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| QLX50_RS14465 (QLX50_14465) | - | 2956033..2956374 (+) | 342 | WP_044801746.1 | hypothetical protein | - |
| QLX50_RS14470 (QLX50_14470) | - | 2956381..2957604 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| QLX50_RS14475 (QLX50_14475) | - | 2957734..2959200 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| QLX50_RS14480 (QLX50_14480) | - | 2959218..2959769 (-) | 552 | WP_282999842.1 | isochorismatase family cysteine hydrolase | - |
| QLX50_RS14485 (QLX50_14485) | - | 2959866..2960264 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=830637 QLX50_RS14460 WP_003152043.1 2955427..2955567(-) (degQ) [Bacillus velezensis strain IFST-221]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=830637 QLX50_RS14460 WP_003152043.1 2955427..2955567(-) (degQ) [Bacillus velezensis strain IFST-221]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |