Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   QLX50_RS11590 Genome accession   NZ_CP125283
Coordinates   2415092..2415406 (-) Length   104 a.a.
NCBI ID   WP_038459179.1    Uniprot ID   -
Organism   Bacillus velezensis strain IFST-221     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2410092..2420406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLX50_RS11545 (QLX50_11545) sinI 2410773..2410946 (+) 174 WP_007612543.1 anti-repressor SinI family protein Regulator
  QLX50_RS11550 (QLX50_11550) sinR 2410980..2411315 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QLX50_RS11555 (QLX50_11555) - 2411363..2412148 (-) 786 WP_044802563.1 TasA family protein -
  QLX50_RS11560 (QLX50_11560) - 2412213..2412797 (-) 585 WP_015240205.1 signal peptidase I -
  QLX50_RS11565 (QLX50_11565) tapA 2412769..2413440 (-) 672 WP_044802562.1 amyloid fiber anchoring/assembly protein TapA -
  QLX50_RS11570 (QLX50_11570) - 2413699..2414028 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  QLX50_RS11575 (QLX50_11575) - 2414063..2414248 (-) 186 WP_044802561.1 YqzE family protein -
  QLX50_RS11580 (QLX50_11580) comGG 2414305..2414682 (-) 378 WP_044802560.1 competence type IV pilus minor pilin ComGG Machinery gene
  QLX50_RS11585 (QLX50_11585) comGF 2414683..2415078 (-) 396 WP_044802559.1 competence type IV pilus minor pilin ComGF -
  QLX50_RS11590 (QLX50_11590) comGE 2415092..2415406 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  QLX50_RS11595 (QLX50_11595) comGD 2415390..2415827 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QLX50_RS11600 (QLX50_11600) comGC 2415817..2416125 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QLX50_RS11605 (QLX50_11605) comGB 2416130..2417167 (-) 1038 WP_044802558.1 competence type IV pilus assembly protein ComGB Machinery gene
  QLX50_RS11610 (QLX50_11610) comGA 2417154..2418224 (-) 1071 WP_007612574.1 competence type IV pilus ATPase ComGA Machinery gene
  QLX50_RS11615 (QLX50_11615) - 2418421..2419371 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11932.91 Da        Isoelectric Point: 5.8321

>NTDB_id=830618 QLX50_RS11590 WP_038459179.1 2415092..2415406(-) (comGE) [Bacillus velezensis strain IFST-221]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=830618 QLX50_RS11590 WP_038459179.1 2415092..2415406(-) (comGE) [Bacillus velezensis strain IFST-221]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACTGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481