Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QLX50_RS11545 Genome accession   NZ_CP125283
Coordinates   2410773..2410946 (+) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain IFST-221     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2405773..2415946
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLX50_RS11530 (QLX50_11530) gcvT 2406586..2407686 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  QLX50_RS11535 (QLX50_11535) - 2408110..2409780 (+) 1671 WP_044802564.1 SNF2-related protein -
  QLX50_RS11540 (QLX50_11540) - 2409802..2410596 (+) 795 WP_007612541.1 YqhG family protein -
  QLX50_RS11545 (QLX50_11545) sinI 2410773..2410946 (+) 174 WP_007612543.1 anti-repressor SinI family protein Regulator
  QLX50_RS11550 (QLX50_11550) sinR 2410980..2411315 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QLX50_RS11555 (QLX50_11555) - 2411363..2412148 (-) 786 WP_044802563.1 TasA family protein -
  QLX50_RS11560 (QLX50_11560) - 2412213..2412797 (-) 585 WP_015240205.1 signal peptidase I -
  QLX50_RS11565 (QLX50_11565) tapA 2412769..2413440 (-) 672 WP_044802562.1 amyloid fiber anchoring/assembly protein TapA -
  QLX50_RS11570 (QLX50_11570) - 2413699..2414028 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  QLX50_RS11575 (QLX50_11575) - 2414063..2414248 (-) 186 WP_044802561.1 YqzE family protein -
  QLX50_RS11580 (QLX50_11580) comGG 2414305..2414682 (-) 378 WP_044802560.1 competence type IV pilus minor pilin ComGG Machinery gene
  QLX50_RS11585 (QLX50_11585) comGF 2414683..2415078 (-) 396 WP_044802559.1 competence type IV pilus minor pilin ComGF -
  QLX50_RS11590 (QLX50_11590) comGE 2415092..2415406 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  QLX50_RS11595 (QLX50_11595) comGD 2415390..2415827 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=830615 QLX50_RS11545 WP_007612543.1 2410773..2410946(+) (sinI) [Bacillus velezensis strain IFST-221]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=830615 QLX50_RS11545 WP_007612543.1 2410773..2410946(+) (sinI) [Bacillus velezensis strain IFST-221]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719