Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   R8623_RS02535 Genome accession   NZ_AP026928
Coordinates   495274..495423 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain PZ900700406     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 490274..500423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8623_RS02510 (PC0401_04890) comA/nlmT 491334..493010 (-) 1677 WP_215729172.1 peptide cleavage/export ABC transporter Regulator
  R8623_RS02515 (PC0401_04900) comA/nlmT 492904..493491 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  R8623_RS02520 (PC0401_04910) blpI 493780..493977 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  R8623_RS02525 (PC0401_04920) blpJ 494444..494713 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  R8623_RS02530 (PC0401_04930) blpK 494782..495030 (+) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  R8623_RS02535 (PC0401_04940) cipB 495274..495423 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R8623_RS10930 - 495459..495524 (+) 66 Protein_499 ComC/BlpC family peptide pheromone/bacteriocin -
  R8623_RS02540 - 495527..495646 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R8623_RS02545 (PC0401_04960) - 496127..496485 (+) 359 Protein_501 immunity protein -
  R8623_RS02550 (PC0401_04980) - 497114..497497 (+) 384 WP_000877381.1 hypothetical protein -
  R8623_RS02555 (PC0401_04990) - 497549..498238 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  R8623_RS02560 (PC0401_05000) blpZ 498280..498513 (+) 234 WP_000276498.1 immunity protein BlpZ -
  R8623_RS02565 - 498664..499275 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  R8623_RS02570 (PC0401_05010) ccrZ 499436..500230 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=83022 R8623_RS02535 WP_001809846.1 495274..495423(+) (cipB) [Streptococcus pneumoniae strain PZ900700406]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=83022 R8623_RS02535 WP_001809846.1 495274..495423(+) (cipB) [Streptococcus pneumoniae strain PZ900700406]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment