Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   QLQ53_RS04615 Genome accession   NZ_CP124911
Coordinates   918394..918921 (+) Length   175 a.a.
NCBI ID   WP_282854022.1    Uniprot ID   -
Organism   Enterococcus faecalis strain EfsC61     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 908481..946139 918394..918921 within 0


Gene organization within MGE regions


Location: 908481..946139
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ53_RS04530 (QLQ53_04530) - 908863..909999 (-) 1137 WP_002401948.1 site-specific integrase -
  QLQ53_RS04535 (QLQ53_04535) - 910124..910708 (-) 585 WP_002401949.1 DUF4352 domain-containing protein -
  QLQ53_RS04540 (QLQ53_04540) - 910790..911047 (-) 258 Protein_876 toxin -
  QLQ53_RS04545 (QLQ53_04545) - 911075..911812 (-) 738 WP_002401950.1 DUF4950 domain-containing protein -
  QLQ53_RS04550 (QLQ53_04550) - 911834..912472 (-) 639 Protein_878 ImmA/IrrE family metallo-endopeptidase -
  QLQ53_RS04555 (QLQ53_04555) - 912487..912831 (-) 345 WP_010731661.1 helix-turn-helix transcriptional regulator -
  QLQ53_RS04560 (QLQ53_04560) - 913141..913317 (+) 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
  QLQ53_RS04565 (QLQ53_04565) - 913331..913669 (+) 339 WP_002401953.1 DUF771 domain-containing protein -
  QLQ53_RS04570 (QLQ53_04570) - 913672..914385 (+) 714 WP_104681384.1 Rha family transcriptional regulator -
  QLQ53_RS04575 (QLQ53_04575) - 914396..914581 (+) 186 WP_002401956.1 hypothetical protein -
  QLQ53_RS04580 (QLQ53_04580) - 914593..914766 (+) 174 WP_002395693.1 hypothetical protein -
  QLQ53_RS04585 (QLQ53_04585) - 914966..915088 (+) 123 WP_002364322.1 hypothetical protein -
  QLQ53_RS04590 (QLQ53_04590) - 915072..915551 (+) 480 WP_002381628.1 siphovirus Gp157 family protein -
  QLQ53_RS04595 (QLQ53_04595) - 915563..916579 (+) 1017 WP_002381629.1 AAA family ATPase -
  QLQ53_RS04600 (QLQ53_04600) - 916584..917225 (+) 642 WP_002401957.1 putative HNHc nuclease -
  QLQ53_RS04605 (QLQ53_04605) - 917245..918096 (+) 852 WP_282854056.1 DNA replication protein -
  QLQ53_RS04610 (QLQ53_04610) - 918096..918404 (+) 309 WP_010783686.1 MazG-like family protein -
  QLQ53_RS04615 (QLQ53_04615) ssb 918394..918921 (+) 528 WP_282854022.1 single-stranded DNA-binding protein Machinery gene
  QLQ53_RS04620 (QLQ53_04620) - 918933..919262 (+) 330 WP_010821535.1 hypothetical protein -
  QLQ53_RS04625 (QLQ53_04625) - 919282..919488 (+) 207 WP_002395813.1 hypothetical protein -
  QLQ53_RS04630 (QLQ53_04630) - 919541..920305 (+) 765 WP_010785682.1 site-specific DNA-methyltransferase -
  QLQ53_RS04635 (QLQ53_04635) - 920349..920843 (+) 495 WP_095725297.1 YopX family protein -
  QLQ53_RS04640 (QLQ53_04640) - 920840..921001 (+) 162 WP_002402357.1 hypothetical protein -
  QLQ53_RS04645 (QLQ53_04645) - 920998..921330 (+) 333 WP_002402358.1 hypothetical protein -
  QLQ53_RS04650 (QLQ53_04650) - 921327..921560 (+) 234 WP_002402359.1 hypothetical protein -
  QLQ53_RS04655 (QLQ53_04655) - 921557..921751 (+) 195 WP_002402360.1 hypothetical protein -
  QLQ53_RS04660 (QLQ53_04660) - 921763..922020 (+) 258 WP_174092930.1 hypothetical protein -
  QLQ53_RS15045 - 922017..922599 (+) 583 Protein_901 ASCH/PUA domain-containing protein -
  QLQ53_RS04675 (QLQ53_04675) - 922613..923098 (+) 486 WP_002389003.1 hypothetical protein -
  QLQ53_RS04680 (QLQ53_04680) - 923099..923281 (+) 183 WP_002389222.1 hypothetical protein -
  QLQ53_RS04685 (QLQ53_04685) - 923464..923667 (+) 204 WP_282854026.1 hypothetical protein -
  QLQ53_RS04690 (QLQ53_04690) - 923703..923852 (-) 150 WP_174092928.1 hypothetical protein -
  QLQ53_RS04695 (QLQ53_04695) - 923940..924347 (+) 408 WP_002364505.1 transcriptional regulator -
  QLQ53_RS04700 (QLQ53_04700) - 924664..925029 (+) 366 WP_033780470.1 hypothetical protein -
  QLQ53_RS04705 (QLQ53_04705) - 925099..925560 (+) 462 WP_002414515.1 terminase small subunit -
  QLQ53_RS04710 (QLQ53_04710) - 925550..926824 (+) 1275 WP_025188082.1 PBSX family phage terminase large subunit -
  QLQ53_RS04715 (QLQ53_04715) - 926837..928312 (+) 1476 WP_025186476.1 phage portal protein -
  QLQ53_RS04720 (QLQ53_04720) - 928287..929333 (+) 1047 WP_282854028.1 phage head morphogenesis protein -
  QLQ53_RS04725 (QLQ53_04725) - 929336..929656 (+) 321 WP_104681295.1 hypothetical protein -
  QLQ53_RS04730 (QLQ53_04730) - 929875..930504 (+) 630 WP_142959624.1 DUF4355 domain-containing protein -
  QLQ53_RS04735 (QLQ53_04735) - 930518..931420 (+) 903 WP_016634610.1 DUF5309 family protein -
  QLQ53_RS04740 (QLQ53_04740) - 931444..931680 (+) 237 WP_002402418.1 hypothetical protein -
  QLQ53_RS04745 (QLQ53_04745) - 931689..932033 (+) 345 WP_002402417.1 hypothetical protein -
  QLQ53_RS04750 (QLQ53_04750) - 932030..932407 (+) 378 WP_002402416.1 hypothetical protein -
  QLQ53_RS04755 (QLQ53_04755) - 932400..932798 (+) 399 WP_002402415.1 HK97 gp10 family phage protein -
  QLQ53_RS04760 (QLQ53_04760) - 932802..933176 (+) 375 WP_002402414.1 DUF6838 family protein -
  QLQ53_RS04765 (QLQ53_04765) - 933177..934019 (+) 843 WP_104681298.1 major tail protein -
  QLQ53_RS04770 (QLQ53_04770) - 934071..934424 (+) 354 WP_002364485.1 hypothetical protein -
  QLQ53_RS04775 (QLQ53_04775) - 934674..937571 (+) 2898 WP_282854057.1 tape measure protein -
  QLQ53_RS15050 - 937561..938294 (+) 734 Protein_923 phage tail protein -
  QLQ53_RS04785 (QLQ53_04785) - 938276..940990 (+) 2715 WP_025192971.1 phage tail spike protein -
  QLQ53_RS04790 (QLQ53_04790) - 941006..941908 (+) 903 WP_104681299.1 phage baseplate upper protein -
  QLQ53_RS04795 (QLQ53_04795) - 941908..942222 (+) 315 WP_104681300.1 hypothetical protein -
  QLQ53_RS04800 (QLQ53_04800) - 942215..942532 (+) 318 WP_025193310.1 hypothetical protein -
  QLQ53_RS04805 (QLQ53_04805) - 942532..943749 (+) 1218 WP_104681301.1 glycerophosphodiester phosphodiesterase -
  QLQ53_RS04810 (QLQ53_04810) - 943775..943981 (+) 207 WP_002395769.1 BhlA/UviB family holin-like peptide -
  QLQ53_RS04815 (QLQ53_04815) - 944023..945126 (+) 1104 WP_104681302.1 SH3 domain-containing protein -
  QLQ53_RS04820 (QLQ53_04820) - 945345..945518 (+) 174 WP_002409502.1 hypothetical protein -
  QLQ53_RS04825 (QLQ53_04825) - 945528..946139 (+) 612 WP_002409501.1 hypothetical protein -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19316.20 Da        Isoelectric Point: 4.7305

>NTDB_id=829194 QLQ53_RS04615 WP_282854022.1 918394..918921(+) (ssb) [Enterococcus faecalis strain EfsC61]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQSSQNSVTGVQNDFESNYAANQNKGLNQQNNSQKMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=829194 QLQ53_RS04615 WP_282854022.1 918394..918921(+) (ssb) [Enterococcus faecalis strain EfsC61]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACAAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAAAGCTTCCAATTATTAGAGTCAAAAAG
CACCAACGAGAATAGAAATAGCGTTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATGATTTCGAGAGTAATTATG
CCGCAAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAAAAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.551

100

0.606

  ssbA Bacillus subtilis subsp. subtilis str. 168

57.865

100

0.589