Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   QLQ59_RS03975 Genome accession   NZ_CP124906
Coordinates   806775..807302 (+) Length   175 a.a.
NCBI ID   WP_104681348.1    Uniprot ID   -
Organism   Enterococcus faecalis strain EfsC49     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 795525..833552 806775..807302 within 0


Gene organization within MGE regions


Location: 795525..833552
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLQ59_RS03885 (QLQ59_03885) - 795525..796718 (+) 1194 WP_002355922.1 GNAT family N-acetyltransferase -
  QLQ59_RS03895 (QLQ59_03895) - 797183..798319 (-) 1137 WP_002401948.1 site-specific integrase -
  QLQ59_RS03900 (QLQ59_03900) - 798444..799028 (-) 585 WP_002401949.1 DUF4352 domain-containing protein -
  QLQ59_RS03905 (QLQ59_03905) - 799110..799367 (-) 258 Protein_752 toxin -
  QLQ59_RS03910 (QLQ59_03910) - 799395..800132 (-) 738 WP_002401950.1 DUF4950 domain-containing protein -
  QLQ59_RS03915 (QLQ59_03915) - 800154..800792 (-) 639 WP_010783680.1 ImmA/IrrE family metallo-endopeptidase -
  QLQ59_RS03920 (QLQ59_03920) - 800807..801151 (-) 345 WP_010731661.1 helix-turn-helix transcriptional regulator -
  QLQ59_RS03925 (QLQ59_03925) - 801461..801637 (+) 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
  QLQ59_RS03930 (QLQ59_03930) - 801651..801989 (+) 339 WP_002401953.1 DUF771 domain-containing protein -
  QLQ59_RS03935 (QLQ59_03935) - 801992..802705 (+) 714 WP_104670706.1 Rha family transcriptional regulator -
  QLQ59_RS03940 (QLQ59_03940) - 802716..802901 (+) 186 WP_002364665.1 hypothetical protein -
  QLQ59_RS03945 (QLQ59_03945) - 802913..803086 (+) 174 WP_002395693.1 hypothetical protein -
  QLQ59_RS03950 (QLQ59_03950) - 803287..804030 (+) 744 WP_002401996.1 ERF family protein -
  QLQ59_RS03955 (QLQ59_03955) - 804030..804968 (+) 939 WP_002401997.1 DUF1351 domain-containing protein -
  QLQ59_RS03960 (QLQ59_03960) - 804965..805606 (+) 642 WP_002401998.1 putative HNHc nuclease -
  QLQ59_RS03965 (QLQ59_03965) - 805626..806477 (+) 852 WP_033780568.1 hypothetical protein -
  QLQ59_RS03970 (QLQ59_03970) - 806477..806785 (+) 309 WP_002381633.1 MazG-like family protein -
  QLQ59_RS03975 (QLQ59_03975) ssb 806775..807302 (+) 528 WP_104681348.1 single-stranded DNA-binding protein Machinery gene
  QLQ59_RS03980 (QLQ59_03980) - 807315..807644 (+) 330 WP_063855926.1 hypothetical protein -
  QLQ59_RS03985 (QLQ59_03985) - 807721..807870 (+) 150 WP_240185670.1 hypothetical protein -
  QLQ59_RS03990 (QLQ59_03990) - 807930..808316 (+) 387 WP_095715052.1 YopX family protein -
  QLQ59_RS03995 (QLQ59_03995) - 808313..808651 (+) 339 WP_113817025.1 hypothetical protein -
  QLQ59_RS04000 (QLQ59_04000) - 808651..809220 (+) 570 WP_105194754.1 DUF1642 domain-containing protein -
  QLQ59_RS04005 (QLQ59_04005) - 809403..809570 (+) 168 WP_113817026.1 hypothetical protein -
  QLQ59_RS04010 (QLQ59_04010) - 809993..810409 (+) 417 WP_002357362.1 ArpU family phage packaging/lysis transcriptional regulator -
  QLQ59_RS04020 (QLQ59_04020) - 811264..812124 (+) 861 WP_002369895.1 hypothetical protein -
  QLQ59_RS04025 (QLQ59_04025) - 812929..813153 (+) 225 WP_002404955.1 hypothetical protein -
  QLQ59_RS04030 (QLQ59_04030) terS 813206..814000 (+) 795 WP_113817027.1 phage terminase small subunit -
  QLQ59_RS04035 (QLQ59_04035) - 813972..815261 (+) 1290 WP_105194787.1 PBSX family phage terminase large subunit -
  QLQ59_RS04040 (QLQ59_04040) - 815274..816749 (+) 1476 WP_105194786.1 phage portal protein -
  QLQ59_RS04045 (QLQ59_04045) - 816724..817767 (+) 1044 WP_113817028.1 phage head morphogenesis protein -
  QLQ59_RS04050 (QLQ59_04050) - 817773..818093 (+) 321 WP_010783706.1 hypothetical protein -
  QLQ59_RS04055 (QLQ59_04055) - 818312..818938 (+) 627 WP_002372028.1 DUF4355 domain-containing protein -
  QLQ59_RS04060 (QLQ59_04060) - 818952..819854 (+) 903 WP_002372024.1 DUF5309 family protein -
  QLQ59_RS04065 (QLQ59_04065) - 819878..820114 (+) 237 WP_002372022.1 hypothetical protein -
  QLQ59_RS04070 (QLQ59_04070) - 820123..820467 (+) 345 WP_002372020.1 hypothetical protein -
  QLQ59_RS04075 (QLQ59_04075) - 820464..820847 (+) 384 WP_113817029.1 hypothetical protein -
  QLQ59_RS04080 (QLQ59_04080) - 820834..821232 (+) 399 WP_002402415.1 HK97 gp10 family phage protein -
  QLQ59_RS04085 (QLQ59_04085) - 821236..821610 (+) 375 WP_105194784.1 DUF6838 family protein -
  QLQ59_RS04090 (QLQ59_04090) - 821611..822453 (+) 843 WP_105194783.1 major tail protein -
  QLQ59_RS04095 (QLQ59_04095) - 822506..822859 (+) 354 WP_002364485.1 hypothetical protein -
  QLQ59_RS04100 (QLQ59_04100) - 823108..826005 (+) 2898 WP_033780571.1 tape measure protein -
  QLQ59_RS04105 (QLQ59_04105) - 825995..826729 (+) 735 WP_002402410.1 tail protein -
  QLQ59_RS04110 (QLQ59_04110) - 826711..829425 (+) 2715 WP_162783240.1 phage tail spike protein -
  QLQ59_RS04115 (QLQ59_04115) - 829441..830316 (+) 876 WP_113817031.1 phage baseplate upper protein -
  QLQ59_RS04120 (QLQ59_04120) - 830309..830626 (+) 318 WP_002385668.1 hypothetical protein -
  QLQ59_RS04125 (QLQ59_04125) - 830619..830936 (+) 318 WP_002385669.1 hypothetical protein -
  QLQ59_RS04130 (QLQ59_04130) - 830936..831445 (+) 510 WP_002394069.1 hypothetical protein -
  QLQ59_RS04135 (QLQ59_04135) - 831462..831836 (+) 375 WP_033780492.1 hypothetical protein -
  QLQ59_RS04140 (QLQ59_04140) - 831836..831973 (+) 138 WP_002399193.1 XkdX family protein -
  QLQ59_RS04145 (QLQ59_04145) - 832007..832240 (+) 234 WP_002383824.1 hemolysin XhlA family protein -
  QLQ59_RS04150 (QLQ59_04150) - 832243..832449 (+) 207 WP_010784051.1 phage holin -
  QLQ59_RS04155 (QLQ59_04155) - 832452..833552 (+) 1101 WP_113817032.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19311.19 Da        Isoelectric Point: 4.6968

>NTDB_id=829119 QLQ59_RS03975 WP_104681348.1 806775..807302(+) (ssb) [Enterococcus faecalis strain EfsC49]
MINNVVLVGRLTKDLDLRYTASGSAVGSFTLAVNRNFTNQNGDREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEPKSANENRNSIQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=829119 QLQ59_RS03975 WP_104681348.1 806775..807302(+) (ssb) [Enterococcus faecalis strain EfsC49]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCTTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAATGGTGACCGTGAAGCAGACTTTATCAACTGTGTGATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGCCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGCGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.551

100

0.606

  ssbA Bacillus subtilis subsp. subtilis str. 168

58.427

100

0.594