Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   QI003_RS15730 Genome accession   NZ_CP124601
Coordinates   3152312..3152659 (-) Length   115 a.a.
NCBI ID   WP_014664592.1    Uniprot ID   -
Organism   Bacillus stercoris strain BS21     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3147312..3157659
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QI003_RS15685 (QI003_15685) sinI 3147845..3148018 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  QI003_RS15690 (QI003_15690) sinR 3148052..3148387 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QI003_RS15695 (QI003_15695) tasA 3148481..3149266 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QI003_RS15700 (QI003_15700) - 3149330..3149902 (-) 573 WP_014664587.1 signal peptidase I -
  QI003_RS15705 (QI003_15705) tapA 3149886..3150641 (-) 756 WP_282372662.1 amyloid fiber anchoring/assembly protein TapA -
  QI003_RS15710 (QI003_15710) - 3150913..3151239 (+) 327 WP_014664589.1 YqzG/YhdC family protein -
  QI003_RS15715 (QI003_15715) - 3151280..3151459 (-) 180 WP_014480252.1 YqzE family protein -
  QI003_RS15720 (QI003_15720) comGG 3151531..3151905 (-) 375 WP_071578591.1 competence type IV pilus minor pilin ComGG Machinery gene
  QI003_RS15725 (QI003_15725) comGF 3151906..3152286 (-) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  QI003_RS15730 (QI003_15730) comGE 3152312..3152659 (-) 348 WP_014664592.1 competence type IV pilus minor pilin ComGE Machinery gene
  QI003_RS15735 (QI003_15735) comGD 3152643..3153074 (-) 432 WP_014664593.1 competence type IV pilus minor pilin ComGD Machinery gene
  QI003_RS15740 (QI003_15740) comGC 3153064..3153360 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QI003_RS15745 (QI003_15745) comGB 3153374..3154411 (-) 1038 WP_282372665.1 competence type IV pilus assembly protein ComGB Machinery gene
  QI003_RS15750 (QI003_15750) comGA 3154398..3155468 (-) 1071 WP_041521378.1 competence protein ComGA Machinery gene
  QI003_RS15755 (QI003_15755) - 3155680..3156090 (-) 411 WP_041521379.1 CBS domain-containing protein -
  QI003_RS15760 (QI003_15760) corA 3156153..3157106 (-) 954 WP_282372667.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13055.93 Da        Isoelectric Point: 4.3481

>NTDB_id=826628 QI003_RS15730 WP_014664592.1 3152312..3152659(-) (comGE) [Bacillus stercoris strain BS21]
MWIGSKGFSTIETMSALSLWLFVLLTVVPLWDKLIADENMSESREIGYQMMNESISKYVMTGEGAASKTMTKNNQTYAMT
WEEEGEYQNVCISAAAYKEKSFCLSILQTEWLHAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=826628 QI003_RS15730 WP_014664592.1 3152312..3152659(-) (comGE) [Bacillus stercoris strain BS21]
ATGTGGATAGGAAGTAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTATGGCTGTTTGTGCTGCTGACAGT
TGTCCCCTTGTGGGACAAGCTGATAGCTGATGAAAATATGTCGGAATCACGAGAAATCGGTTATCAGATGATGAATGAGA
GCATTAGCAAATATGTCATGACTGGTGAAGGAGCCGCGTCAAAAACGATGACAAAGAACAACCAGACCTATGCTATGACG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGCATCTCAGCGGCAGCTTATAAAGAGAAATCATTTTGCCTCAGCATTCT
GCAGACAGAATGGCTACACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

89.565

100

0.896