Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QI003_RS15685 Genome accession   NZ_CP124601
Coordinates   3147845..3148018 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus stercoris strain BS21     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3142845..3153018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QI003_RS15670 (QI003_15670) gcvT 3143643..3144731 (-) 1089 WP_282372661.1 glycine cleavage system aminomethyltransferase GcvT -
  QI003_RS15675 (QI003_15675) - 3145173..3146846 (+) 1674 WP_069149860.1 SNF2-related protein -
  QI003_RS15680 (QI003_15680) - 3146867..3147661 (+) 795 WP_014664585.1 YqhG family protein -
  QI003_RS15685 (QI003_15685) sinI 3147845..3148018 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  QI003_RS15690 (QI003_15690) sinR 3148052..3148387 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QI003_RS15695 (QI003_15695) tasA 3148481..3149266 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QI003_RS15700 (QI003_15700) - 3149330..3149902 (-) 573 WP_014664587.1 signal peptidase I -
  QI003_RS15705 (QI003_15705) tapA 3149886..3150641 (-) 756 WP_282372662.1 amyloid fiber anchoring/assembly protein TapA -
  QI003_RS15710 (QI003_15710) - 3150913..3151239 (+) 327 WP_014664589.1 YqzG/YhdC family protein -
  QI003_RS15715 (QI003_15715) - 3151280..3151459 (-) 180 WP_014480252.1 YqzE family protein -
  QI003_RS15720 (QI003_15720) comGG 3151531..3151905 (-) 375 WP_071578591.1 competence type IV pilus minor pilin ComGG Machinery gene
  QI003_RS15725 (QI003_15725) comGF 3151906..3152286 (-) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  QI003_RS15730 (QI003_15730) comGE 3152312..3152659 (-) 348 WP_014664592.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=826624 QI003_RS15685 WP_003230187.1 3147845..3148018(+) (sinI) [Bacillus stercoris strain BS21]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=826624 QI003_RS15685 WP_003230187.1 3147845..3148018(+) (sinI) [Bacillus stercoris strain BS21]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1