Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   QEZ42_RS06990 Genome accession   NZ_CP124202
Coordinates   1376261..1376767 (+) Length   168 a.a.
NCBI ID   WP_281486960.1    Uniprot ID   -
Organism   Lysinibacillus sphaericus strain FY22.JlqLf     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1367525..1416330 1376261..1376767 within 0


Gene organization within MGE regions


Location: 1367525..1416330
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QEZ42_RS06915 - 1367525..1368640 (-) 1116 WP_281486946.1 tyrosine-type recombinase/integrase -
  QEZ42_RS06920 - 1368703..1369749 (-) 1047 WP_281486947.1 ImmA/IrrE family metallo-endopeptidase -
  QEZ42_RS06925 - 1369724..1370074 (-) 351 WP_281486948.1 helix-turn-helix transcriptional regulator -
  QEZ42_RS06930 - 1370378..1370569 (+) 192 WP_281486949.1 hypothetical protein -
  QEZ42_RS06935 - 1370602..1371366 (+) 765 WP_281486950.1 Bro-N domain-containing protein -
  QEZ42_RS06940 - 1371367..1371684 (+) 318 WP_281486951.1 DUF771 domain-containing protein -
  QEZ42_RS06945 - 1371834..1372220 (+) 387 WP_281486952.1 hypothetical protein -
  QEZ42_RS06950 - 1372204..1372356 (+) 153 WP_281486953.1 hypothetical protein -
  QEZ42_RS06955 - 1372371..1372541 (+) 171 WP_281486954.1 hypothetical protein -
  QEZ42_RS06960 - 1372605..1373234 (+) 630 WP_281486955.1 ERF family protein -
  QEZ42_RS06965 - 1373246..1374091 (+) 846 WP_281486956.1 phage replisome organizer N-terminal domain-containing protein -
  QEZ42_RS06970 - 1374091..1375326 (+) 1236 WP_281486957.1 DnaB-like helicase C-terminal domain-containing protein -
  QEZ42_RS06975 - 1375313..1375747 (+) 435 WP_281486958.1 hypothetical protein -
  QEZ42_RS06980 - 1375754..1375909 (+) 156 WP_164908755.1 hypothetical protein -
  QEZ42_RS06985 - 1375896..1376264 (+) 369 WP_281486959.1 YopX family protein -
  QEZ42_RS06990 ssbA 1376261..1376767 (+) 507 WP_281486960.1 single-stranded DNA-binding protein Machinery gene
  QEZ42_RS06995 - 1376785..1377246 (+) 462 WP_281486961.1 RusA family crossover junction endodeoxyribonuclease -
  QEZ42_RS07000 - 1377264..1377680 (+) 417 WP_281486962.1 hypothetical protein -
  QEZ42_RS07005 - 1377743..1378981 (+) 1239 WP_281486963.1 DNA cytosine methyltransferase -
  QEZ42_RS07010 - 1379013..1379429 (+) 417 WP_281486964.1 transcriptional regulator -
  QEZ42_RS07015 - 1379466..1379822 (+) 357 WP_281486965.1 hypothetical protein -
  QEZ42_RS07020 - 1380096..1381229 (+) 1134 WP_281486966.1 ATP-binding protein -
  QEZ42_RS07025 - 1381226..1381990 (+) 765 WP_281486967.1 DUF3226 domain-containing protein -
  QEZ42_RS07030 - 1382125..1382676 (+) 552 WP_281486968.1 hypothetical protein -
  QEZ42_RS07035 - 1382791..1383045 (+) 255 WP_281486969.1 hypothetical protein -
  QEZ42_RS07040 - 1383121..1383333 (+) 213 WP_281486970.1 hypothetical protein -
  QEZ42_RS07045 - 1383542..1385014 (+) 1473 WP_281486971.1 hypothetical protein -
  QEZ42_RS07050 - 1385257..1385523 (+) 267 WP_281486972.1 hypothetical protein -
  QEZ42_RS07055 - 1385525..1385842 (+) 318 WP_281486973.1 hypothetical protein -
  QEZ42_RS07060 - 1385832..1386212 (+) 381 WP_281486974.1 HNH endonuclease -
  QEZ42_RS07065 - 1386342..1386860 (+) 519 WP_281486975.1 phage terminase small subunit P27 family -
  QEZ42_RS07070 - 1386857..1388560 (+) 1704 WP_281486976.1 terminase TerL endonuclease subunit -
  QEZ42_RS07075 - 1388612..1389814 (+) 1203 WP_281487128.1 phage portal protein -
  QEZ42_RS07080 - 1389840..1390559 (+) 720 WP_281487129.1 head maturation protease, ClpP-related -
  QEZ42_RS07085 - 1390626..1391816 (+) 1191 WP_281487130.1 phage major capsid protein -
  QEZ42_RS07090 - 1391860..1392093 (+) 234 WP_281486977.1 hypothetical protein -
  QEZ42_RS07095 - 1392093..1392425 (+) 333 WP_281486978.1 head-tail connector protein -
  QEZ42_RS07100 - 1392403..1392738 (+) 336 WP_281486979.1 phage head closure protein -
  QEZ42_RS07105 - 1392739..1393158 (+) 420 WP_281486980.1 HK97-gp10 family putative phage morphogenesis protein -
  QEZ42_RS07110 - 1393155..1393499 (+) 345 WP_281486981.1 hypothetical protein -
  QEZ42_RS07115 - 1393519..1394103 (+) 585 WP_281486982.1 major tail protein -
  QEZ42_RS07120 - 1394176..1394481 (+) 306 WP_281486983.1 hypothetical protein -
  QEZ42_RS07125 - 1394685..1399661 (+) 4977 WP_281486984.1 phage tail tape measure protein -
  QEZ42_RS07130 - 1399666..1400556 (+) 891 WP_281486985.1 phage tail domain-containing protein -
  QEZ42_RS07135 - 1400559..1401671 (+) 1113 WP_281486986.1 siphovirus ReqiPepy6 Gp37-like family protein -
  QEZ42_RS07140 - 1401671..1403224 (+) 1554 WP_281486987.1 hypothetical protein -
  QEZ42_RS07145 - 1403244..1403558 (+) 315 WP_281486988.1 hypothetical protein -
  QEZ42_RS07150 - 1403940..1404239 (+) 300 WP_237497350.1 hypothetical protein -
  QEZ42_RS07155 - 1404229..1404489 (+) 261 WP_089987110.1 phage holin -
  QEZ42_RS07160 - 1404486..1405154 (+) 669 WP_281486989.1 M15 family metallopeptidase -
  QEZ42_RS07165 - 1405417..1406253 (+) 837 WP_281486990.1 discoidin domain-containing protein -
  QEZ42_RS07170 - 1406387..1406743 (+) 357 WP_281486991.1 aconitate hydratase -
  QEZ42_RS07175 - 1406770..1407186 (-) 417 WP_281486992.1 type II toxin-antitoxin system HicB family antitoxin -
  QEZ42_RS07180 - 1407213..1407404 (-) 192 WP_196243961.1 type II toxin-antitoxin system HicA family toxin -
  QEZ42_RS07185 - 1407539..1408279 (-) 741 WP_036167096.1 FxLYD domain-containing protein -
  QEZ42_RS07190 - 1408356..1408577 (-) 222 WP_036167099.1 helix-turn-helix transcriptional regulator -
  QEZ42_RS07195 - 1408764..1409597 (+) 834 WP_281486993.1 helix-turn-helix domain-containing protein -
  QEZ42_RS07200 - 1409700..1410452 (+) 753 WP_281486994.1 hypothetical protein -
  QEZ42_RS07205 - 1410909..1411250 (-) 342 WP_281486995.1 tyrosine-type recombinase/integrase -
  QEZ42_RS07210 - 1411270..1411371 (-) 102 Protein_1333 IS3 family transposase -
  QEZ42_RS07215 - 1411584..1412030 (+) 447 Protein_1334 N-acetylmuramoyl-L-alanine amidase -
  QEZ42_RS07220 - 1412420..1413100 (+) 681 WP_031419361.1 hypothetical protein -
  QEZ42_RS07225 - 1413575..1413840 (-) 266 Protein_1336 IS3 family transposase -
  QEZ42_RS07230 - 1414938..1415336 (+) 399 WP_281486996.1 hypothetical protein -
  QEZ42_RS07235 - 1415644..1416330 (+) 687 WP_012295540.1 DUF421 domain-containing protein -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18622.38 Da        Isoelectric Point: 5.8182

>NTDB_id=823902 QEZ42_RS06990 WP_281486960.1 1376261..1376767(+) (ssbA) [Lysinibacillus sphaericus strain FY22.JlqLf]
MINRVVLVGRLTKDPELRYTPNGIASCRFTLAVNRAFKSEGEQQADFIQCVAWRKQAENLANFQRKGNLIGVEGRIQTGS
YESQDGKRVYTTDVVADSIQFLEHKNGSESAQNDSNARSDTNRGVGSQNGSEGHRGPQNTQPNYTRVDEDPFANSKGPGE
VKEEDLPF

Nucleotide


Download         Length: 507 bp        

>NTDB_id=823902 QEZ42_RS06990 WP_281486960.1 1376261..1376767(+) (ssbA) [Lysinibacillus sphaericus strain FY22.JlqLf]
ATGATTAACCGCGTTGTACTAGTTGGCCGTTTAACTAAAGATCCTGAATTACGCTACACACCAAATGGCATTGCATCATG
TCGCTTCACATTAGCTGTTAATCGTGCTTTCAAAAGTGAAGGTGAACAGCAAGCCGATTTTATCCAGTGTGTTGCTTGGA
GAAAACAGGCTGAGAATCTAGCAAACTTTCAGCGAAAAGGTAATTTAATAGGCGTTGAGGGCCGTATTCAAACAGGAAGT
TATGAAAGTCAGGATGGCAAGCGTGTGTACACGACAGACGTTGTAGCCGATAGCATTCAATTCTTAGAGCATAAAAACGG
CTCAGAAAGCGCTCAGAACGATTCGAACGCACGTTCTGATACAAATAGAGGGGTAGGTTCTCAAAACGGCTCAGAAGGTC
ACAGAGGGCCTCAAAACACACAGCCAAATTATACAAGGGTAGACGAAGATCCATTTGCAAATAGCAAAGGCCCTGGTGAA
GTAAAAGAAGAAGATCTTCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

49.444

100

0.53

  ssb Latilactobacillus sakei subsp. sakei 23K

48.837

100

0.5