Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R8625_RS00215 Genome accession   NZ_AP026923
Coordinates   38775..38933 (+) Length   52 a.a.
NCBI ID   WP_050214718.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PZ900700054     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 33775..43933
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8625_RS00185 (PC0054_00300) - 33913..34923 (-) 1011 WP_050204489.1 YeiH family protein -
  R8625_RS00190 (PC0054_00310) - 35072..36241 (+) 1170 WP_000366351.1 pyridoxal phosphate-dependent aminotransferase -
  R8625_RS00195 (PC0054_00320) recO 36238..37008 (+) 771 WP_000616164.1 DNA repair protein RecO Machinery gene
  R8625_RS00200 (PC0054_00330) plsX 37005..37997 (+) 993 WP_000717456.1 phosphate acyltransferase PlsX -
  R8625_RS00205 (PC0054_00340) - 38003..38236 (+) 234 WP_000136447.1 acyl carrier protein -
  R8625_RS00210 (PC0054_00350) - 38273..38572 (+) 300 Protein_34 transposase family protein -
  R8625_RS00215 (PC0054_00360) cipB 38775..38933 (+) 159 WP_050214718.1 bacteriocin class II family protein Regulator
  R8625_RS00220 - 38936..39061 (+) 126 WP_001842754.1 PncF family bacteriocin immunity protein -
  R8625_RS00225 (PC0054_00370) comA 39647..41800 (+) 2154 WP_050214717.1 peptide cleavage/export ABC transporter ComA Regulator
  R8625_RS00230 (PC0054_00380) comB 41813..43162 (+) 1350 WP_050214715.1 competence pheromone export protein ComB Regulator

Sequence

Protein


Download         Length: 52 a.a.        Molecular weight: 5408.19 Da        Isoelectric Point: 3.9522

>NTDB_id=82388 R8625_RS00215 WP_050214718.1 38775..38933(+) (cipB) [Streptococcus pneumoniae strain PZ900700054]
MNTKTMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW

Nucleotide


Download         Length: 159 bp        

>NTDB_id=82388 R8625_RS00215 WP_050214718.1 38775..38933(+) (cipB) [Streptococcus pneumoniae strain PZ900700054]
ATGAATACAAAAACGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-51)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44

96.154

0.423

Multiple sequence alignment