Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   QHF92_RS12640 Genome accession   NZ_CP123994
Coordinates   2524941..2525324 (-) Length   127 a.a.
NCBI ID   WP_060399016.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain M3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2519941..2530324
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QHF92_RS12600 (QHF92_12600) sinI 2520869..2521042 (+) 174 WP_003226347.1 anti-repressor SinI family protein Regulator
  QHF92_RS12605 (QHF92_12605) sinR 2521076..2521411 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QHF92_RS12610 (QHF92_12610) tasA 2521506..2522291 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  QHF92_RS12615 (QHF92_12615) - 2522355..2522927 (-) 573 WP_080429111.1 signal peptidase I -
  QHF92_RS12620 (QHF92_12620) tapA 2522911..2523675 (-) 765 WP_060399014.1 amyloid fiber anchoring/assembly protein TapA -
  QHF92_RS12625 (QHF92_12625) - 2523948..2524274 (+) 327 WP_029316858.1 YqzG/YhdC family protein -
  QHF92_RS12630 (QHF92_12630) - 2524316..2524495 (-) 180 WP_003236949.1 YqzE family protein -
  QHF92_RS12635 (QHF92_12635) comGG 2524566..2524940 (-) 375 WP_060399015.1 competence type IV pilus minor pilin ComGG Machinery gene
  QHF92_RS12640 (QHF92_12640) comGF 2524941..2525324 (-) 384 WP_060399016.1 competence type IV pilus minor pilin ComGF Machinery gene
  QHF92_RS12645 (QHF92_12645) comGE 2525350..2525694 (-) 345 WP_060399017.1 competence type IV pilus minor pilin ComGE Machinery gene
  QHF92_RS12650 (QHF92_12650) comGD 2525678..2526109 (-) 432 WP_060399018.1 competence type IV pilus minor pilin ComGD Machinery gene
  QHF92_RS12655 (QHF92_12655) comGC 2526099..2526395 (-) 297 WP_003236957.1 comG operon protein ComGC Machinery gene
  QHF92_RS12660 (QHF92_12660) comGB 2526409..2527446 (-) 1038 WP_060399019.1 competence type IV pilus assembly protein ComGB Machinery gene
  QHF92_RS12665 (QHF92_12665) comGA 2527433..2528503 (-) 1071 WP_060399020.1 competence protein ComGA Machinery gene
  QHF92_RS12670 (QHF92_12670) - 2528466..2528741 (-) 276 WP_060399021.1 hypothetical protein -
  QHF92_RS12675 (QHF92_12675) - 2528719..2529129 (-) 411 WP_060399022.1 CBS domain-containing protein -
  QHF92_RS12680 (QHF92_12680) corA 2529192..2530136 (-) 945 WP_003236968.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14472.80 Da        Isoelectric Point: 7.9434

>NTDB_id=823729 QHF92_RS12640 WP_060399016.1 2524941..2525324(-) (comGF) [Bacillus inaquosorum strain M3]
MLISGSLAMIFHLFLSRQQEHDGFTQQEWMISTEQMMNECKKSQIVKIAEHGRVLICTNLSGQDIRFETYHSMIRKRVDG
KGHVPILYHITAMKADIENGIVLLNIKSKDEKVYQTAFPVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=823729 QHF92_RS12640 WP_060399016.1 2524941..2525324(-) (comGF) [Bacillus inaquosorum strain M3]
TTGCTCATATCAGGATCGTTAGCTATGATCTTCCATCTGTTTTTGTCACGACAGCAGGAGCATGACGGTTTCACACAGCA
AGAATGGATGATTTCAACGGAGCAGATGATGAACGAGTGCAAGAAGTCTCAAATAGTCAAGATAGCCGAGCATGGGAGAG
TATTGATCTGCACCAATCTTTCCGGGCAAGACATCCGTTTTGAAACCTATCATTCAATGATCAGAAAAAGGGTGGATGGC
AAAGGGCATGTGCCGATTCTCTATCATATTACTGCCATGAAAGCTGATATTGAAAATGGGATTGTGTTGTTAAATATTAA
GAGCAAGGATGAAAAAGTGTATCAAACTGCTTTTCCGGTTTATACGTCTTTAGGAGGAGGATGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

86.614

100

0.866