Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QEP20_RS16275 Genome accession   NZ_CP123977
Coordinates   3122981..3123121 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain WH60A     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3117981..3128121
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QEP20_RS16250 (QEP20_16250) yuxO 3118257..3118637 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  QEP20_RS16255 (QEP20_16255) comA 3118656..3119300 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QEP20_RS16260 (QEP20_16260) comP 3119381..3121693 (-) 2313 WP_069703660.1 histidine kinase Regulator
  QEP20_RS16265 (QEP20_16265) comX 3121709..3121930 (-) 222 WP_014480704.1 competence pheromone ComX -
  QEP20_RS16270 (QEP20_16270) - 3121932..3122795 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  QEP20_RS16275 (QEP20_16275) degQ 3122981..3123121 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QEP20_RS16280 (QEP20_16280) - 3123343..3123405 (+) 63 Protein_3141 hypothetical protein -
  QEP20_RS16285 (QEP20_16285) - 3123583..3123951 (+) 369 WP_017695529.1 hypothetical protein -
  QEP20_RS16290 (QEP20_16290) pdeH 3123927..3125156 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QEP20_RS16295 (QEP20_16295) pncB 3125293..3126765 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QEP20_RS16300 (QEP20_16300) pncA 3126781..3127332 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  QEP20_RS16305 (QEP20_16305) yueI 3127429..3127827 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=823502 QEP20_RS16275 WP_003220708.1 3122981..3123121(-) (degQ) [Bacillus subtilis subsp. subtilis strain WH60A]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=823502 QEP20_RS16275 WP_003220708.1 3122981..3123121(-) (degQ) [Bacillus subtilis subsp. subtilis strain WH60A]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1