Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   OU418_RS16910 Genome accession   NZ_CP123621
Coordinates   3215483..3215623 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain RLI2019     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3210483..3220623
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OU418_RS16885 (OU418_16885) yuxO 3210826..3211206 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  OU418_RS16890 (OU418_16890) comA 3211225..3211869 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  OU418_RS16895 (OU418_16895) comP 3211950..3214250 (-) 2301 WP_088300729.1 histidine kinase Regulator
  OU418_RS16900 (OU418_16900) comX 3214262..3214426 (-) 165 WP_015384519.1 competence pheromone ComX -
  OU418_RS16905 (OU418_16905) - 3214439..3215299 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  OU418_RS16910 (OU418_16910) degQ 3215483..3215623 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  OU418_RS16915 (OU418_16915) - 3215845..3215907 (+) 63 Protein_3275 hypothetical protein -
  OU418_RS16920 (OU418_16920) - 3216086..3216454 (+) 369 WP_041850584.1 hypothetical protein -
  OU418_RS16925 (OU418_16925) pdeH 3216430..3217659 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  OU418_RS16930 (OU418_16930) pncB 3217796..3219268 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  OU418_RS16935 (OU418_16935) pncA 3219284..3219835 (-) 552 WP_043940186.1 cysteine hydrolase family protein -
  OU418_RS16940 (OU418_16940) yueI 3219932..3220330 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=821786 OU418_RS16910 WP_003220708.1 3215483..3215623(-) (degQ) [Bacillus subtilis strain RLI2019]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=821786 OU418_RS16910 WP_003220708.1 3215483..3215623(-) (degQ) [Bacillus subtilis strain RLI2019]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1