Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OU418_RS13005 Genome accession   NZ_CP123621
Coordinates   2504045..2504218 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain RLI2019     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2499045..2509218
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OU418_RS12990 (OU418_12990) gcvT 2499845..2500933 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  OU418_RS12995 (OU418_12995) hepAA 2501374..2503047 (+) 1674 WP_041850014.1 DEAD/DEAH box helicase -
  OU418_RS13000 (OU418_13000) yqhG 2503068..2503862 (+) 795 WP_003230200.1 YqhG family protein -
  OU418_RS13005 (OU418_13005) sinI 2504045..2504218 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OU418_RS13010 (OU418_13010) sinR 2504252..2504587 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OU418_RS13015 (OU418_13015) tasA 2504680..2505465 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  OU418_RS13020 (OU418_13020) sipW 2505529..2506101 (-) 573 WP_003246088.1 signal peptidase I SipW -
  OU418_RS13025 (OU418_13025) tapA 2506085..2506846 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  OU418_RS13030 (OU418_13030) yqzG 2507118..2507444 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OU418_RS13035 (OU418_13035) spoIITA 2507486..2507665 (-) 180 WP_003230176.1 YqzE family protein -
  OU418_RS13040 (OU418_13040) comGG 2507736..2508110 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  OU418_RS13045 (OU418_13045) comGF 2508111..2508494 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  OU418_RS13050 (OU418_13050) comGE 2508520..2508867 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=821762 OU418_RS13005 WP_003230187.1 2504045..2504218(+) (sinI) [Bacillus subtilis strain RLI2019]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=821762 OU418_RS13005 WP_003230187.1 2504045..2504218(+) (sinI) [Bacillus subtilis strain RLI2019]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1