Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   QFC96_RS03600 Genome accession   NZ_CP123581
Coordinates   679322..679786 (+) Length   154 a.a.
NCBI ID   WP_283534037.1    Uniprot ID   -
Organism   Latilactobacillus curvatus strain ZHA1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 666632..704119 679322..679786 within 0


Gene organization within MGE regions


Location: 666632..704119
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QFC96_RS03470 (QFC96_03470) - 666632..667777 (-) 1146 WP_283534325.1 site-specific integrase -
  QFC96_RS03475 (QFC96_03475) - 668035..669642 (-) 1608 WP_283534326.1 SIR2 family protein -
  QFC96_RS03480 (QFC96_03480) - 669785..670246 (-) 462 WP_283534327.1 DUF4429 domain-containing protein -
  QFC96_RS03485 (QFC96_03485) - 670325..670738 (-) 414 WP_283534328.1 ImmA/IrrE family metallo-endopeptidase -
  QFC96_RS03490 (QFC96_03490) - 670752..671114 (-) 363 WP_283534329.1 helix-turn-helix transcriptional regulator -
  QFC96_RS03495 (QFC96_03495) - 671389..671580 (+) 192 WP_283534330.1 helix-turn-helix transcriptional regulator -
  QFC96_RS03500 (QFC96_03500) - 671621..672319 (+) 699 WP_283534331.1 Rha family transcriptional regulator -
  QFC96_RS03505 (QFC96_03505) - 672336..672527 (+) 192 WP_283534332.1 hypothetical protein -
  QFC96_RS03510 (QFC96_03510) - 672541..672858 (+) 318 WP_283534333.1 DUF771 domain-containing protein -
  QFC96_RS03515 (QFC96_03515) - 672848..673051 (+) 204 WP_283534334.1 hypothetical protein -
  QFC96_RS03520 (QFC96_03520) - 673048..673218 (+) 171 WP_283534052.1 hypothetical protein -
  QFC96_RS03525 (QFC96_03525) - 673219..673422 (+) 204 WP_283534051.1 hypothetical protein -
  QFC96_RS03530 (QFC96_03530) - 673419..674279 (+) 861 WP_283534335.1 lambda-exonuclease family protein -
  QFC96_RS03535 (QFC96_03535) - 674283..675074 (+) 792 WP_283534336.1 recombinase RecT -
  QFC96_RS03540 (QFC96_03540) - 675087..675989 (+) 903 WP_283534337.1 DnaD domain protein -
  QFC96_RS03545 (QFC96_03545) - 675992..676195 (+) 204 WP_283534338.1 hypothetical protein -
  QFC96_RS03550 (QFC96_03550) - 676195..676623 (+) 429 WP_283534339.1 hypothetical protein -
  QFC96_RS03555 (QFC96_03555) - 676616..676789 (+) 174 WP_283534045.1 hypothetical protein -
  QFC96_RS03560 (QFC96_03560) - 677089..677307 (+) 219 WP_283534044.1 hypothetical protein -
  QFC96_RS03565 (QFC96_03565) - 677313..677558 (+) 246 WP_283534043.1 hypothetical protein -
  QFC96_RS03570 (QFC96_03570) - 677558..677686 (+) 129 WP_277850853.1 hypothetical protein -
  QFC96_RS03575 (QFC96_03575) - 677686..678150 (+) 465 WP_283534042.1 DUF1064 domain-containing protein -
  QFC96_RS03580 (QFC96_03580) - 678162..678365 (+) 204 WP_283534041.1 hypothetical protein -
  QFC96_RS03585 (QFC96_03585) - 678385..678903 (+) 519 WP_283534040.1 hypothetical protein -
  QFC96_RS03590 (QFC96_03590) - 678917..679099 (+) 183 WP_283534039.1 hypothetical protein -
  QFC96_RS03595 (QFC96_03595) - 679099..679335 (+) 237 WP_283534038.1 helix-turn-helix transcriptional regulator -
  QFC96_RS03600 (QFC96_03600) ssb 679322..679786 (+) 465 WP_283534037.1 single-stranded DNA-binding protein Machinery gene
  QFC96_RS03605 (QFC96_03605) - 679870..680319 (+) 450 WP_283534036.1 sigma-70 family RNA polymerase sigma factor -
  QFC96_RS03610 (QFC96_03610) - 680459..681094 (+) 636 WP_283534035.1 hypothetical protein -
  QFC96_RS03615 (QFC96_03615) - 681431..681733 (+) 303 WP_283534034.1 hypothetical protein -
  QFC96_RS03620 (QFC96_03620) - 681840..682175 (+) 336 WP_283534340.1 hypothetical protein -
  QFC96_RS03625 (QFC96_03625) - 682150..683832 (+) 1683 WP_283534341.1 terminase TerL endonuclease subunit -
  QFC96_RS03630 (QFC96_03630) - 683851..685053 (+) 1203 WP_283534342.1 phage portal protein -
  QFC96_RS03635 (QFC96_03635) - 685016..685849 (+) 834 WP_283534343.1 head maturation protease, ClpP-related -
  QFC96_RS03640 (QFC96_03640) - 685862..686983 (+) 1122 WP_283534029.1 phage major capsid protein -
  QFC96_RS03645 (QFC96_03645) - 686995..687231 (+) 237 WP_283534028.1 Ig-like domain-containing protein -
  QFC96_RS03650 (QFC96_03650) - 687242..687541 (+) 300 WP_283534027.1 head-tail connector protein -
  QFC96_RS03655 (QFC96_03655) - 687528..687923 (+) 396 WP_283534344.1 head-tail adaptor protein -
  QFC96_RS03660 (QFC96_03660) - 687904..688260 (+) 357 WP_283534345.1 hypothetical protein -
  QFC96_RS03665 (QFC96_03665) - 688250..688648 (+) 399 WP_283534346.1 HK97-gp10 family putative phage morphogenesis protein -
  QFC96_RS03670 (QFC96_03670) - 688663..689247 (+) 585 WP_283534347.1 phage tail protein -
  QFC96_RS03675 (QFC96_03675) - 689304..689492 (+) 189 Protein_700 Ig-like domain-containing protein -
  QFC96_RS03680 (QFC96_03680) - 689561..689923 (+) 363 WP_283534348.1 hypothetical protein -
  QFC96_RS03685 (QFC96_03685) - 689974..690096 (+) 123 WP_283534349.1 hypothetical protein -
  QFC96_RS03690 (QFC96_03690) - 690114..693335 (+) 3222 WP_283534350.1 phage tail tape measure protein -
  QFC96_RS03695 (QFC96_03695) - 693335..694021 (+) 687 WP_283534351.1 hypothetical protein -
  QFC96_RS03700 (QFC96_03700) - 694018..698130 (+) 4113 WP_283534019.1 phage tail spike protein -
  QFC96_RS03705 (QFC96_03705) - 698127..698558 (+) 432 WP_283534018.1 DUF1617 family protein -
  QFC96_RS03710 (QFC96_03710) - 698558..698785 (+) 228 WP_283534017.1 hypothetical protein -
  QFC96_RS03715 (QFC96_03715) - 698801..699073 (+) 273 WP_101377749.1 hypothetical protein -
  QFC96_RS03720 (QFC96_03720) - 699078..699332 (+) 255 WP_213923378.1 phage holin -
  QFC96_RS03725 (QFC96_03725) - 699332..700141 (+) 810 WP_283534352.1 N-acetylmuramoyl-L-alanine amidase -
  QFC96_RS03730 (QFC96_03730) - 700392..700718 (+) 327 WP_004270346.1 MazG-like family protein -
  QFC96_RS03735 (QFC96_03735) - 700974..701174 (+) 201 WP_004270328.1 cold-shock protein -
  QFC96_RS03740 (QFC96_03740) - 701329..702051 (-) 723 WP_283534353.1 SDR family oxidoreductase -
  QFC96_RS03745 (QFC96_03745) - 702341..702778 (+) 438 WP_004270330.1 universal stress protein -
  QFC96_RS03750 (QFC96_03750) - 702941..704119 (+) 1179 WP_215499351.1 serine hydrolase -

Sequence


Protein


Download         Length: 154 a.a.        Molecular weight: 16937.58 Da        Isoelectric Point: 7.9298

>NTDB_id=821372 QFC96_RS03600 WP_283534037.1 679322..679786(+) (ssb) [Latilactobacillus curvatus strain ZHA1]
MKMNSANLIGNLTRDPELKYSQSGMALMSCNIAVRRQFKDKQSGDYESDFINIKAFGKTAELFSNSFRKGSKVGVTGTIQ
TGRYENNQGQTVYTTDIIVNSMTFVEAKSSDGGSNSNQTNYTSNGQTGYNKPNNQSQTYNNGQPIDISDDQLPV

Nucleotide


Download         Length: 465 bp        

>NTDB_id=821372 QFC96_RS03600 WP_283534037.1 679322..679786(+) (ssb) [Latilactobacillus curvatus strain ZHA1]
ATGAAGATGAATAGCGCTAATTTAATTGGTAACTTGACGCGTGATCCTGAATTGAAATACAGTCAAAGCGGCATGGCGTT
GATGAGTTGTAACATTGCTGTTAGACGGCAGTTTAAAGATAAACAAAGTGGTGATTACGAATCTGACTTTATTAATATCA
AAGCATTTGGCAAAACAGCCGAGTTGTTCAGTAATAGTTTCCGCAAAGGTTCAAAGGTTGGTGTGACTGGTACGATTCAA
ACCGGCCGTTACGAAAATAATCAAGGTCAAACTGTTTACACCACCGACATCATTGTTAATTCGATGACGTTCGTTGAAGC
TAAAAGCAGTGATGGCGGTTCGAATAGCAATCAGACGAATTATACTAGCAACGGCCAGACTGGTTACAATAAGCCAAACA
ATCAATCGCAAACCTATAATAATGGACAACCGATTGATATAAGCGATGATCAGTTACCGGTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

45.882

100

0.506

  ssbA Bacillus subtilis subsp. subtilis str. 168

37.427

100

0.416