Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4703_RS06365 Genome accession   NZ_CP137100
Coordinates   1155429..1155587 (+) Length   52 a.a.
NCBI ID   WP_001093073.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain LYP     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1150429..1160587
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4703_RS06340 - 1151726..1152895 (+) 1170 WP_023396089.1 pyridoxal phosphate-dependent aminotransferase -
  R4703_RS06345 recO 1152892..1153662 (+) 771 WP_050201061.1 DNA repair protein RecO Machinery gene
  R4703_RS06350 plsX 1153659..1154651 (+) 993 WP_023396091.1 phosphate acyltransferase PlsX -
  R4703_RS06355 - 1154657..1154890 (+) 234 WP_000136446.1 acyl carrier protein -
  R4703_RS06360 - 1154927..1155226 (+) 300 Protein_1205 transposase family protein -
  R4703_RS06365 cipB 1155429..1155587 (+) 159 WP_001093073.1 bacteriocin class II family protein Regulator
  R4703_RS06370 - 1155590..1155715 (+) 126 WP_000346297.1 PncF family bacteriocin immunity protein -
  R4703_RS06375 comA 1156306..1158459 (+) 2154 WP_000668282.1 peptide cleavage/export ABC transporter ComA Regulator
  R4703_RS06380 comB 1158472..1159821 (+) 1350 WP_000801620.1 competence pheromone export protein ComB Regulator

Sequence

Protein


Download         Length: 52 a.a.        Molecular weight: 5435.25 Da        Isoelectric Point: 4.2644

>NTDB_id=818463 R4703_RS06365 WP_001093073.1 1155429..1155587(+) (cipB) [Streptococcus pneumoniae strain LYP]
MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW

Nucleotide


Download         Length: 159 bp        

>NTDB_id=818463 R4703_RS06365 WP_001093073.1 1155429..1155587(+) (cipB) [Streptococcus pneumoniae strain LYP]
ATGAATACAAAAAAGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-51)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44

96.154

0.423