Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   QAO27_RS05880 Genome accession   NZ_CP123086
Coordinates   1174197..1174640 (-) Length   147 a.a.
NCBI ID   WP_001099009.1    Uniprot ID   A0A0C6EXF8
Organism   Staphylococcus aureus strain MSSA-ATCC29213     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1133751..1184660 1174197..1174640 within 0


Gene organization within MGE regions


Location: 1133751..1184660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAO27_RS05600 (QAO27_05600) - 1133751..1134578 (-) 828 WP_000927632.1 sulfite exporter TauE/SafE family protein -
  QAO27_RS05605 (QAO27_05605) - 1134591..1135439 (-) 849 WP_000608129.1 DUF72 domain-containing protein -
  QAO27_RS05610 (QAO27_05610) - 1135487..1135570 (-) 84 WP_016170465.1 hypothetical protein -
  QAO27_RS05615 (QAO27_05615) - 1135824..1136891 (-) 1068 WP_000267236.1 NAD(P)H-dependent flavin oxidoreductase -
  QAO27_RS05620 (QAO27_05620) - 1136905..1137945 (-) 1041 WP_000582326.1 hemolysin family protein -
  QAO27_RS05625 (QAO27_05625) - 1138310..1138624 (+) 315 WP_000274029.1 hypothetical protein -
  QAO27_RS05630 (QAO27_05630) - 1138630..1138769 (-) 140 Protein_1081 hypothetical protein -
  QAO27_RS05635 (QAO27_05635) - 1139634..1140191 (+) 558 WP_031768989.1 DUF4888 domain-containing protein -
  QAO27_RS05640 (QAO27_05640) - 1140252..1141664 (-) 1413 WP_031768990.1 N-acetylmuramoyl-L-alanine amidase -
  QAO27_RS05645 (QAO27_05645) - 1141651..1141926 (-) 276 WP_000351119.1 phage holin -
  QAO27_RS05650 (QAO27_05650) - 1141982..1142377 (-) 396 WP_016170466.1 hypothetical protein -
  QAO27_RS05655 (QAO27_05655) - 1142383..1143621 (-) 1239 WP_016170467.1 BppU family phage baseplate upper protein -
  QAO27_RS05660 (QAO27_05660) - 1143634..1145532 (-) 1899 WP_001836236.1 N-acetylglucosaminidase -
  QAO27_RS05665 (QAO27_05665) - 1145669..1145968 (-) 300 WP_000466777.1 DUF2951 domain-containing protein -
  QAO27_RS05670 (QAO27_05670) - 1146008..1146181 (-) 174 WP_000782200.1 XkdX family protein -
  QAO27_RS05675 (QAO27_05675) - 1146185..1146562 (-) 378 WP_000705896.1 DUF2977 domain-containing protein -
  QAO27_RS05680 (QAO27_05680) - 1146562..1148385 (-) 1824 WP_031768991.1 phage baseplate upper protein -
  QAO27_RS05685 (QAO27_05685) - 1148385..1150295 (-) 1911 WP_031768993.1 hypothetical protein -
  QAO27_RS05690 (QAO27_05690) - 1150310..1152211 (-) 1902 WP_031768995.1 SGNH/GDSL hydrolase family protein -
  QAO27_RS05695 (QAO27_05695) - 1152220..1153167 (-) 948 WP_000350683.1 phage tail family protein -
  QAO27_RS05700 (QAO27_05700) - 1153180..1156647 (-) 3468 WP_031768997.1 membrane protein -
  QAO27_RS05705 (QAO27_05705) - 1156664..1157008 (-) 345 WP_000105584.1 hypothetical protein -
  QAO27_RS05710 (QAO27_05710) - 1157038..1157403 (-) 366 WP_001100163.1 tail assembly chaperone -
  QAO27_RS05715 (QAO27_05715) - 1157465..1158046 (-) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  QAO27_RS05720 (QAO27_05720) - 1158065..1158448 (-) 384 WP_000188649.1 hypothetical protein -
  QAO27_RS05725 (QAO27_05725) - 1158460..1158807 (-) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  QAO27_RS05730 (QAO27_05730) - 1158807..1159109 (-) 303 WP_001268312.1 hypothetical protein -
  QAO27_RS05735 (QAO27_05735) - 1159106..1159438 (-) 333 WP_000208960.1 phage head-tail connector protein -
  QAO27_RS05740 (QAO27_05740) - 1159447..1159734 (-) 288 WP_001114085.1 hypothetical protein -
  QAO27_RS05745 (QAO27_05745) - 1159756..1160730 (-) 975 WP_031768999.1 phage major capsid protein -
  QAO27_RS05750 (QAO27_05750) - 1160744..1161358 (-) 615 WP_000354309.1 DUF4355 domain-containing protein -
  QAO27_RS05755 (QAO27_05755) - 1161493..1161663 (-) 171 WP_000072207.1 hypothetical protein -
  QAO27_RS05760 (QAO27_05760) - 1161736..1162731 (-) 996 WP_001556698.1 minor capsid protein -
  QAO27_RS05765 (QAO27_05765) - 1162738..1164273 (-) 1536 WP_031769000.1 phage portal protein -
  QAO27_RS05770 (QAO27_05770) - 1164284..1165561 (-) 1278 WP_031769002.1 PBSX family phage terminase large subunit -
  QAO27_RS05775 (QAO27_05775) - 1165548..1165988 (-) 441 WP_001003272.1 terminase small subunit -
  QAO27_RS05780 (QAO27_05780) - 1166175..1166594 (-) 420 WP_000058634.1 transcriptional regulator -
  QAO27_RS05785 (QAO27_05785) - 1166609..1166755 (-) 147 WP_000989961.1 hypothetical protein -
  QAO27_RS05790 (QAO27_05790) - 1166756..1167118 (-) 363 WP_000383791.1 hypothetical protein -
  QAO27_RS05795 (QAO27_05795) rinB 1167119..1167292 (-) 174 WP_000595257.1 transcriptional activator RinB -
  QAO27_RS05800 (QAO27_05800) - 1167285..1167521 (-) 237 WP_031769004.1 hypothetical protein -
  QAO27_RS05805 (QAO27_05805) - 1167546..1167782 (-) 237 WP_000195831.1 DUF1381 domain-containing protein -
  QAO27_RS05810 (QAO27_05810) - 1167819..1168346 (-) 528 WP_000185638.1 dUTP diphosphatase -
  QAO27_RS05815 (QAO27_05815) - 1168339..1168587 (-) 249 WP_031769005.1 DUF1024 family protein -
  QAO27_RS05820 (QAO27_05820) - 1168601..1168849 (-) 249 WP_078066199.1 SAV1978 family virulence-associated passenger protein -
  QAO27_RS05825 (QAO27_05825) - 1168858..1169058 (-) 201 WP_031769006.1 hypothetical protein -
  QAO27_RS05830 (QAO27_05830) - 1169061..1169318 (-) 258 WP_031769008.1 DUF3310 domain-containing protein -
  QAO27_RS05835 (QAO27_05835) - 1169318..1169935 (-) 618 WP_031769009.1 SA1788 family PVL leukocidin-associated protein -
  QAO27_RS05840 (QAO27_05840) - 1169936..1170121 (-) 186 WP_001187242.1 DUF3113 family protein -
  QAO27_RS05845 (QAO27_05845) - 1170126..1170530 (-) 405 WP_031769010.1 DUF1064 domain-containing protein -
  QAO27_RS05850 (QAO27_05850) - 1170541..1170762 (-) 222 WP_001123673.1 DUF3269 family protein -
  QAO27_RS05855 (QAO27_05855) - 1170775..1170936 (-) 162 WP_000237153.1 hypothetical protein -
  QAO27_RS05860 (QAO27_05860) - 1170930..1171703 (-) 774 WP_031769012.1 ATP-binding protein -
  QAO27_RS05865 (QAO27_05865) - 1171713..1172483 (-) 771 WP_031769013.1 conserved phage C-terminal domain-containing protein -
  QAO27_RS05870 (QAO27_05870) - 1172548..1173405 (+) 858 WP_000371250.1 DUF4393 domain-containing protein -
  QAO27_RS05875 (QAO27_05875) - 1173511..1174185 (-) 675 WP_031769015.1 putative HNHc nuclease -
  QAO27_RS05880 (QAO27_05880) ssbA 1174197..1174640 (-) 444 WP_001099009.1 single-stranded DNA-binding protein Machinery gene
  QAO27_RS05885 (QAO27_05885) - 1174637..1175287 (-) 651 WP_000840496.1 ERF family protein -
  QAO27_RS05890 (QAO27_05890) - 1175288..1175824 (-) 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
  QAO27_RS05895 (QAO27_05895) - 1175837..1176097 (-) 261 WP_000291067.1 DUF1108 family protein -
  QAO27_RS05900 (QAO27_05900) - 1176102..1176404 (-) 303 WP_000165363.1 DUF2482 family protein -
  QAO27_RS05905 (QAO27_05905) - 1176397..1176714 (-) 318 WP_031769017.1 hypothetical protein -
  QAO27_RS05910 (QAO27_05910) - 1176825..1176968 (-) 144 WP_031769019.1 DUF1270 family protein -
  QAO27_RS05915 (QAO27_05915) - 1176961..1177182 (-) 222 WP_064129667.1 hypothetical protein -
  QAO27_RS05920 (QAO27_05920) - 1177196..1177645 (-) 450 WP_001094943.1 hypothetical protein -
  QAO27_RS05925 (QAO27_05925) tscA 1177685..1177909 (-) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  QAO27_RS05930 (QAO27_05930) - 1177910..1178677 (-) 768 WP_001002757.1 phage antirepressor Ant -
  QAO27_RS05935 (QAO27_05935) - 1178677..1178871 (-) 195 WP_000108122.1 multiprotein-bridging factor 1 family protein -
  QAO27_RS05940 (QAO27_05940) - 1179134..1179466 (+) 333 WP_001055143.1 helix-turn-helix domain-containing protein -
  QAO27_RS05945 (QAO27_05945) - 1179483..1180157 (+) 675 WP_000775187.1 ImmA/IrrE family metallo-endopeptidase -
  QAO27_RS05950 (QAO27_05950) - 1180185..1180910 (+) 726 WP_000661437.1 PH domain-containing protein -
  QAO27_RS05955 (QAO27_05955) - 1180942..1181874 (+) 933 WP_000392186.1 hypothetical protein -
  QAO27_RS05960 (QAO27_05960) - 1181854..1182033 (-) 180 WP_000337826.1 hypothetical protein -
  QAO27_RS05965 (QAO27_05965) - 1182146..1183195 (+) 1050 WP_031769022.1 tyrosine-type recombinase/integrase -
  QAO27_RS05970 (QAO27_05970) sufB 1183263..1184660 (-) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -

Sequence

Protein


Download         Length: 147 a.a.        Molecular weight: 16321.89 Da        Isoelectric Point: 5.8347

>NTDB_id=818436 QAO27_RS05880 WP_001099009.1 1174197..1174640(-) (ssbA) [Staphylococcus aureus strain MSSA-ATCC29213]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=818436 QAO27_RS05880 WP_001099009.1 1174197..1174640(-) (ssbA) [Staphylococcus aureus strain MSSA-ATCC29213]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-100)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0C6EXF8

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

41.279

100

0.483
  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.442