Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   QAO32_RS00580 Genome accession   NZ_CP123070
Coordinates   97070..97513 (+) Length   147 a.a.
NCBI ID   WP_001099009.1    Uniprot ID   A0A0C6EXF8
Organism   Staphylococcus aureus strain SW-MSSA64     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 88831..133259 97070..97513 within 0


Gene organization within MGE regions


Location: 88831..133259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAO32_RS00500 (QAO32_00495) - 88831..89877 (-) 1047 WP_001145722.1 tyrosine-type recombinase/integrase -
  QAO32_RS00505 (QAO32_00500) - 90088..90768 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  QAO32_RS00510 (QAO32_00505) - 90800..91525 (-) 726 WP_053872064.1 PH domain-containing protein -
  QAO32_RS00515 (QAO32_00510) - 91553..92227 (-) 675 WP_000775187.1 ImmA/IrrE family metallo-endopeptidase -
  QAO32_RS00520 (QAO32_00515) - 92244..92576 (-) 333 WP_001055143.1 helix-turn-helix domain-containing protein -
  QAO32_RS00525 (QAO32_00520) - 92839..93033 (+) 195 WP_015977910.1 multiprotein-bridging factor 1 family protein -
  QAO32_RS00530 (QAO32_00525) - 93033..93800 (+) 768 WP_001002757.1 phage antirepressor Ant -
  QAO32_RS00535 (QAO32_00530) tscA 93801..94025 (+) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  QAO32_RS00540 (QAO32_00535) - 94065..94514 (+) 450 WP_001094943.1 hypothetical protein -
  QAO32_RS00545 (QAO32_00540) - 94528..94749 (+) 222 WP_000977381.1 hypothetical protein -
  QAO32_RS00550 (QAO32_00545) - 94742..94903 (+) 162 WP_070852600.1 DUF1270 family protein -
  QAO32_RS00555 (QAO32_00550) - 94996..95313 (+) 318 WP_000829612.1 hypothetical protein -
  QAO32_RS00560 (QAO32_00555) - 95306..95608 (+) 303 WP_000163431.1 DUF2482 family protein -
  QAO32_RS00565 (QAO32_00560) - 95613..95873 (+) 261 WP_000291481.1 DUF1108 family protein -
  QAO32_RS00570 (QAO32_00565) - 95886..96422 (+) 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
  QAO32_RS00575 (QAO32_00570) - 96423..97073 (+) 651 WP_000840496.1 ERF family protein -
  QAO32_RS00580 (QAO32_00575) ssbA 97070..97513 (+) 444 WP_001099009.1 single-stranded DNA-binding protein Machinery gene
  QAO32_RS00585 (QAO32_00580) - 97525..98199 (+) 675 WP_000057263.1 putative HNHc nuclease -
  QAO32_RS00590 (QAO32_00585) - 98196..98345 (+) 150 WP_001081076.1 hypothetical protein -
  QAO32_RS00595 (QAO32_00590) - 98338..98619 (-) 282 WP_000414755.1 hypothetical protein -
  QAO32_RS00600 (QAO32_00595) - 98685..99455 (+) 771 WP_000190254.1 conserved phage C-terminal domain-containing protein -
  QAO32_RS00605 (QAO32_00600) - 99465..100244 (+) 780 WP_000803062.1 ATP-binding protein -
  QAO32_RS00610 (QAO32_00605) - 100238..100396 (+) 159 WP_000256589.1 hypothetical protein -
  QAO32_RS00615 (QAO32_00610) - 100409..100630 (+) 222 WP_001123695.1 DUF3269 family protein -
  QAO32_RS00620 (QAO32_00615) - 100640..101044 (+) 405 WP_000049795.1 DUF1064 domain-containing protein -
  QAO32_RS00625 (QAO32_00620) - 101049..101234 (+) 186 WP_001187235.1 DUF3113 family protein -
  QAO32_RS00630 (QAO32_00625) - 101235..101606 (+) 372 Protein_125 SA1788 family PVL leukocidin-associated protein -
  QAO32_RS00635 (QAO32_00630) - 101607..101855 (+) 249 WP_015980409.1 phi PVL orf 51-like protein -
  QAO32_RS00640 (QAO32_00635) - 101920..102369 (+) 450 WP_000982708.1 YopX family protein -
  QAO32_RS00645 (QAO32_00640) - 102366..102731 (+) 366 WP_411905311.1 acetyltransferase -
  QAO32_RS00650 (QAO32_00645) - 102724..102957 (+) 234 WP_053507579.1 DUF1024 family protein -
  QAO32_RS00655 (QAO32_00650) - 102950..103486 (+) 537 WP_411905312.1 dUTP diphosphatase -
  QAO32_RS00660 (QAO32_00655) - 103523..103699 (+) 177 Protein_131 DUF1381 domain-containing protein -
  QAO32_RS00665 (QAO32_00660) rinB 103803..103952 (+) 150 WP_000595265.1 transcriptional activator RinB -
  QAO32_RS00670 (QAO32_00665) - 103953..104318 (+) 366 WP_000455357.1 hypothetical protein -
  QAO32_RS00675 (QAO32_00670) - 104319..104465 (+) 147 WP_176442183.1 hypothetical protein -
  QAO32_RS00680 (QAO32_00675) - 104480..104899 (+) 420 WP_000058632.1 transcriptional regulator -
  QAO32_RS00685 (QAO32_00680) - 105086..105526 (+) 441 WP_001003271.1 terminase small subunit -
  QAO32_RS00690 (QAO32_00685) - 105513..106790 (+) 1278 WP_031769002.1 PBSX family phage terminase large subunit -
  QAO32_RS00695 (QAO32_00690) - 106801..108336 (+) 1536 WP_015977939.1 phage portal protein -
  QAO32_RS00700 (QAO32_00695) - 108343..109338 (+) 996 WP_001555735.1 minor capsid protein -
  QAO32_RS00705 (QAO32_00700) - 109411..109581 (+) 171 WP_000072206.1 hypothetical protein -
  QAO32_RS00710 (QAO32_00705) - 109609..109696 (+) 88 Protein_141 hypothetical protein -
  QAO32_RS00715 (QAO32_00710) - 109690..110310 (+) 621 WP_000392140.1 DUF4355 domain-containing protein -
  QAO32_RS00720 (QAO32_00715) - 110324..111298 (+) 975 WP_000438502.1 phage major capsid protein -
  QAO32_RS00725 (QAO32_00720) - 111320..111607 (+) 288 WP_001114091.1 hypothetical protein -
  QAO32_RS00730 (QAO32_00725) - 111616..111948 (+) 333 WP_000208960.1 phage head-tail connector protein -
  QAO32_RS00735 (QAO32_00730) - 111945..112247 (+) 303 WP_001268312.1 hypothetical protein -
  QAO32_RS00740 (QAO32_00735) - 112247..112594 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  QAO32_RS00745 (QAO32_00740) - 112606..112989 (+) 384 WP_000188649.1 hypothetical protein -
  QAO32_RS00750 (QAO32_00745) - 113008..113589 (+) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  QAO32_RS00755 (QAO32_00750) - 113651..114016 (+) 366 WP_001100163.1 tail assembly chaperone -
  QAO32_RS00760 (QAO32_00755) - 114046..114390 (+) 345 WP_031928996.1 hypothetical protein -
  QAO32_RS00765 (QAO32_00760) - 114407..117874 (+) 3468 WP_411905315.1 hypothetical protein -
  QAO32_RS00770 (QAO32_00765) - 117887..118834 (+) 948 WP_000350680.1 phage tail family protein -
  QAO32_RS00775 (QAO32_00770) - 118843..120744 (+) 1902 WP_000156404.1 SGNH/GDSL hydrolase family protein -
  QAO32_RS00780 (QAO32_00775) - 120759..122669 (+) 1911 WP_031928995.1 hypothetical protein -
  QAO32_RS00785 (QAO32_00780) - 122669..124492 (+) 1824 WP_015977938.1 phage baseplate upper protein -
  QAO32_RS00790 (QAO32_00785) - 124492..124869 (+) 378 WP_000705888.1 DUF2977 domain-containing protein -
  QAO32_RS00795 (QAO32_00790) - 124879..125052 (+) 174 WP_001790193.1 XkdX family protein -
  QAO32_RS00800 (QAO32_00795) - 125093..125392 (+) 300 WP_000466784.1 DUF2951 domain-containing protein -
  QAO32_RS00805 (QAO32_00800) - 125529..127427 (+) 1899 WP_000524007.1 glucosaminidase domain-containing protein -
  QAO32_RS00810 (QAO32_00805) - 127440..128612 (+) 1173 WP_000276623.1 BppU family phage baseplate upper protein -
  QAO32_RS00815 (QAO32_00810) - 128618..129013 (+) 396 WP_000398878.1 hypothetical protein -
  QAO32_RS00820 (QAO32_00815) - 129069..129506 (+) 438 WP_000354132.1 phage holin -
  QAO32_RS00825 (QAO32_00820) - 129487..130932 (+) 1446 WP_072541049.1 SH3 domain-containing protein -
  QAO32_RS00830 (QAO32_00825) - 131175..131327 (+) 153 WP_001788502.1 hypothetical protein -
  QAO32_RS00835 (QAO32_00830) - 131398..131508 (+) 111 WP_000139423.1 hypothetical protein -
  QAO32_RS00840 (QAO32_00835) - 131510..131695 (+) 186 WP_001286805.1 hypothetical protein -
  QAO32_RS00845 (QAO32_00840) - 132021..132122 (-) 102 WP_011447034.1 hypothetical protein -
  QAO32_RS00850 (QAO32_00845) - 132449..132610 (+) 162 WP_001005407.1 SE1561 family protein -
  QAO32_RS00855 (QAO32_00850) - 132744..133259 (+) 516 WP_000163283.1 type 1 glutamine amidotransferase domain-containing protein -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16321.89 Da        Isoelectric Point: 5.8347

>NTDB_id=818112 QAO32_RS00580 WP_001099009.1 97070..97513(+) (ssbA) [Staphylococcus aureus strain SW-MSSA64]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=818112 QAO32_RS00580 WP_001099009.1 97070..97513(+) (ssbA) [Staphylococcus aureus strain SW-MSSA64]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0C6EXF8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

41.279

100

0.483

  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.442