Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAP06_RS07120 Genome accession   NZ_CP122954
Coordinates   1487544..1487657 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain BS06     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1482544..1492657
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP06_RS07100 (QAP06_07100) - 1483222..1484634 (-) 1413 WP_286465614.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  QAP06_RS07105 (QAP06_07105) comB10 1484704..1485834 (-) 1131 WP_286465615.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP06_RS07110 (QAP06_07110) comB9 1485827..1486804 (-) 978 WP_286465617.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP06_RS07115 (QAP06_07115) comB8 1486804..1487547 (-) 744 WP_286465618.1 virB8 family protein Machinery gene
  QAP06_RS07120 (QAP06_07120) comB7 1487544..1487657 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  QAP06_RS07125 (QAP06_07125) comB6 1487673..1488728 (-) 1056 WP_286467626.1 P-type conjugative transfer protein TrbL Machinery gene
  QAP06_RS07130 (QAP06_07130) - 1488736..1489740 (-) 1005 WP_140547967.1 PDZ domain-containing protein -
  QAP06_RS07135 (QAP06_07135) - 1489740..1490042 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  QAP06_RS07140 (QAP06_07140) panD 1490045..1490398 (-) 354 WP_140478563.1 aspartate 1-decarboxylase -
  QAP06_RS07145 (QAP06_07145) - 1490388..1492613 (-) 2226 WP_286465621.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=817451 QAP06_RS07120 WP_001217873.1 1487544..1487657(-) (comB7) [Helicobacter pylori strain BS06]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=817451 QAP06_RS07120 WP_001217873.1 1487544..1487657(-) (comB7) [Helicobacter pylori strain BS06]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
TACTTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1