Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGA   Type   Machinery gene
Locus tag   P8596_RS15385 Genome accession   NZ_CP122397
Coordinates   2946276..2946674 (-) Length   132 a.a.
NCBI ID   WP_279724264.1    Uniprot ID   -
Organism   Rossellomorea sp. DA94     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2946773..2987660 2946276..2946674 flank 99


Gene organization within MGE regions


Location: 2946276..2987660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P8596_RS15385 (P8596_15385) comGA 2946276..2946674 (-) 399 WP_279724264.1 ATPase, T2SS/T4P/T4SS family Machinery gene
  P8596_RS15390 (P8596_15390) - 2946773..2946964 (+) 192 WP_279724265.1 hypothetical protein -
  P8596_RS15395 (P8596_15395) - 2947024..2947350 (-) 327 WP_279724266.1 hypothetical protein -
  P8596_RS15400 (P8596_15400) - 2947366..2950716 (-) 3351 WP_279724267.1 cell wall-binding repeat-containing protein -
  P8596_RS15405 (P8596_15405) - 2950938..2951942 (-) 1005 WP_279724268.1 N-acetylmuramoyl-L-alanine amidase -
  P8596_RS15410 (P8596_15410) - 2951988..2952269 (-) 282 WP_279724269.1 phage holin -
  P8596_RS15415 (P8596_15415) - 2952275..2952709 (-) 435 WP_279724270.1 hypothetical protein -
  P8596_RS15420 (P8596_15420) - 2952806..2953186 (-) 381 WP_279724271.1 hypothetical protein -
  P8596_RS15425 (P8596_15425) - 2953240..2953362 (-) 123 WP_279724272.1 hypothetical protein -
  P8596_RS15430 (P8596_15430) - 2953400..2957068 (-) 3669 WP_279724273.1 phage tail spike protein -
  P8596_RS15435 (P8596_15435) - 2957065..2958570 (-) 1506 WP_279724274.1 distal tail protein Dit -
  P8596_RS15440 (P8596_15440) - 2958582..2960903 (-) 2322 WP_279724275.1 hypothetical protein -
  P8596_RS15445 (P8596_15445) - 2960908..2961234 (-) 327 WP_279724276.1 hypothetical protein -
  P8596_RS15450 (P8596_15450) - 2961276..2961665 (-) 390 WP_279724277.1 tail assembly chaperone -
  P8596_RS15455 (P8596_15455) - 2961725..2962267 (-) 543 WP_279724278.1 phage major tail protein, TP901-1 family -
  P8596_RS15460 (P8596_15460) - 2962283..2962672 (-) 390 WP_279724279.1 hypothetical protein -
  P8596_RS15465 (P8596_15465) - 2962681..2963022 (-) 342 WP_279724280.1 HK97-gp10 family putative phage morphogenesis protein -
  P8596_RS15470 (P8596_15470) - 2963324..2963656 (-) 333 WP_279724281.1 phage head-tail connector protein -
  P8596_RS15475 (P8596_15475) - 2963661..2963987 (-) 327 WP_279724282.1 hypothetical protein -
  P8596_RS15480 (P8596_15480) - 2964019..2964957 (-) 939 WP_279724283.1 phage major capsid protein -
  P8596_RS15485 (P8596_15485) - 2964973..2965620 (-) 648 WP_279724284.1 DUF4355 domain-containing protein -
  P8596_RS15490 (P8596_15490) - 2965753..2966643 (-) 891 WP_279724285.1 minor capsid protein -
  P8596_RS15495 (P8596_15495) - 2966713..2968158 (-) 1446 WP_279724286.1 phage portal protein -
  P8596_RS15500 (P8596_15500) - 2968169..2969455 (-) 1287 WP_279724287.1 PBSX family phage terminase large subunit -
  P8596_RS15505 (P8596_15505) - 2969445..2969879 (-) 435 WP_279724288.1 terminase small subunit -
  P8596_RS15510 (P8596_15510) - 2970111..2971007 (-) 897 WP_279724289.1 DUF4435 domain-containing protein -
  P8596_RS15515 (P8596_15515) - 2971007..2972347 (-) 1341 WP_279724290.1 AAA family ATPase -
  P8596_RS15520 (P8596_15520) - 2972446..2972892 (-) 447 WP_279724291.1 ArpU family phage packaging/lysis transcriptional regulator -
  P8596_RS15525 (P8596_15525) - 2973000..2973665 (-) 666 WP_279724292.1 hypothetical protein -
  P8596_RS15530 (P8596_15530) - 2973662..2973862 (-) 201 WP_279724293.1 XtrA/YqaO family protein -
  P8596_RS15535 (P8596_15535) - 2974315..2974461 (+) 147 WP_279724294.1 hypothetical protein -
  P8596_RS15540 (P8596_15540) - 2974568..2974720 (+) 153 WP_279724295.1 hypothetical protein -
  P8596_RS15545 (P8596_15545) - 2974794..2975210 (-) 417 WP_279727013.1 RusA family crossover junction endodeoxyribonuclease -
  P8596_RS15550 (P8596_15550) - 2975220..2975423 (-) 204 WP_279724296.1 hypothetical protein -
  P8596_RS15555 (P8596_15555) - 2975428..2976282 (-) 855 WP_279724297.1 DnaD domain protein -
  P8596_RS23845 - 2976413..2976556 (-) 144 Protein_3027 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  P8596_RS15565 (P8596_15565) - 2976725..2977570 (-) 846 WP_279724299.1 recombinase RecT -
  P8596_RS15570 (P8596_15570) - 2977570..2978511 (-) 942 WP_279724300.1 lambda-exonuclease family protein -
  P8596_RS15575 (P8596_15575) - 2978622..2978837 (-) 216 WP_279724301.1 hypothetical protein -
  P8596_RS15580 (P8596_15580) - 2979056..2979304 (-) 249 WP_279724302.1 hypothetical protein -
  P8596_RS15585 (P8596_15585) - 2979301..2979819 (-) 519 WP_279724303.1 helix-turn-helix transcriptional regulator -
  P8596_RS15590 (P8596_15590) - 2979996..2980226 (-) 231 WP_279727014.1 helix-turn-helix transcriptional regulator -
  P8596_RS15595 (P8596_15595) - 2980400..2980777 (+) 378 WP_279724304.1 helix-turn-helix transcriptional regulator -
  P8596_RS15600 (P8596_15600) - 2980906..2982837 (-) 1932 WP_279724305.1 hypothetical protein -
  P8596_RS15605 (P8596_15605) - 2982914..2983663 (-) 750 WP_279724306.1 hypothetical protein -
  P8596_RS15610 (P8596_15610) - 2983715..2984671 (-) 957 WP_279724307.1 DNA/RNA non-specific endonuclease -
  P8596_RS15615 (P8596_15615) - 2985147..2985413 (-) 267 WP_279724308.1 NUMOD4 domain-containing protein -
  P8596_RS15620 (P8596_15620) - 2985379..2986050 (-) 672 WP_279724309.1 hypothetical protein -
  P8596_RS15625 (P8596_15625) - 2986237..2986794 (-) 558 WP_279724310.1 hypothetical protein -
  P8596_RS15630 (P8596_15630) - 2986806..2987660 (-) 855 WP_279724311.1 SAR2788 family putative toxin -

Sequence

Protein


Download         Length: 132 a.a.        Molecular weight: 14927.44 Da        Isoelectric Point: 9.2440

>NTDB_id=815352 P8596_RS15385 WP_279724264.1 2946276..2946674(-) (comGA) [Rossellomorea sp. DA94]
MHGSIIITGHLVISTLHTRDAKGAIYRLMELGIEWNDIEQTLLAVSAQRLLKLLCPICKAECGGKCLRGKNRNRASVYEI
ITGSSLKEVLKEAKGERAEHQYRTLQALICKGVALGFVSEHEYRKWVHEEKR

Nucleotide


Download         Length: 399 bp        

>NTDB_id=815352 P8596_RS15385 WP_279724264.1 2946276..2946674(-) (comGA) [Rossellomorea sp. DA94]
GTGCATGGTTCTATTATTATCACAGGTCATTTGGTGATCTCGACTTTGCATACTAGAGATGCAAAAGGGGCGATATATCG
CTTGATGGAATTGGGGATCGAGTGGAATGATATCGAACAGACGCTGCTTGCTGTATCTGCTCAGAGATTACTGAAGCTCC
TCTGTCCGATCTGCAAAGCAGAATGTGGCGGAAAGTGTCTTAGGGGGAAAAACCGTAACAGGGCATCTGTCTATGAAATC
ATTACGGGAAGCTCTTTGAAGGAAGTATTGAAGGAGGCTAAGGGCGAGAGGGCGGAACATCAGTATCGCACATTGCAGGC
TTTAATATGTAAGGGGGTGGCACTCGGATTTGTTTCAGAACATGAATATAGGAAATGGGTTCATGAAGAAAAGCGATGA

Domains

Predicted by InterproScan.

Type II/IV secretion system protein (T2SSE)

(7-52)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGA Bacillus subtilis subsp. subtilis str. 168

52.381

95.455

0.5