Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R8474_RS07630 Genome accession   NZ_AP026914
Coordinates   1507876..1508025 (-) Length   49 a.a.
NCBI ID   WP_001820573.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PZ900700003     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1502876..1513025
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8474_RS07595 - 1503388..1503999 (-) 612 WP_000394036.1 CPBP family intramembrane glutamic endopeptidase -
  R8474_RS07600 (PC0003_15040) blpZ 1504150..1504383 (-) 234 WP_000276498.1 immunity protein BlpZ -
  R8474_RS07605 (PC0003_15050) - 1504423..1505112 (-) 690 WP_000760534.1 CPBP family intramembrane glutamic endopeptidase -
  R8474_RS07610 (PC0003_15060) - 1505144..1505377 (-) 234 WP_000379956.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  R8474_RS10690 (PC0003_15070) - 1505684..1506085 (-) 402 WP_372237104.1 LPXTG cell wall anchor domain-containing protein -
  R8474_RS10695 (PC0003_15080) - 1506116..1506653 (-) 538 Protein_1507 thioredoxin domain-containing protein -
  R8474_RS07620 (PC0003_15090) - 1506814..1507172 (-) 359 Protein_1508 immunity protein -
  R8474_RS07625 - 1507653..1507772 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R8474_RS10700 - 1507775..1507840 (-) 66 Protein_1510 ComC/BlpC family peptide pheromone/bacteriocin -
  R8474_RS07630 (PC0003_15110) cipB 1507876..1508025 (-) 150 WP_001820573.1 bacteriocin-like peptide BlpO Regulator
  R8474_RS07635 (PC0003_15120) blpN 1508269..1508472 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R8474_RS07640 (PC0003_15130) blpM 1508488..1508742 (-) 255 WP_000379877.1 two-peptide bacteriocin subunit BlpM -
  R8474_RS07645 - 1508895..1509699 (-) 805 Protein_1514 IS5 family transposase -
  R8474_RS07650 (PC0003_15170) - 1510702..1510896 (-) 195 WP_050150399.1 hypothetical protein -
  R8474_RS07655 (PC0003_15180) - 1511214..1511417 (-) 204 WP_001093272.1 bacteriocin class II family protein -
  R8474_RS07660 (PC0003_15190) comA/nlmT 1511707..1512294 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.91 Da        Isoelectric Point: 3.9133

>NTDB_id=81382 R8474_RS07630 WP_001820573.1 1507876..1508025(-) (cipB) [Streptococcus pneumoniae strain PZ900700003]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=81382 R8474_RS07630 WP_001820573.1 1507876..1508025(-) (cipB) [Streptococcus pneumoniae strain PZ900700003]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment