Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KI219_RS08550 Genome accession   NZ_AP023089
Coordinates   1712872..1713012 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain RSC-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1707872..1718012
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KI219_RS08525 (RSC2_01781) - 1708173..1708562 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  KI219_RS08530 (RSC2_01782) comA 1708579..1709217 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  KI219_RS08535 - 1709304..1711615 (-) 2312 Protein_1696 ATP-binding protein -
  KI219_RS08540 (RSC2_01785) comX 1711627..1711800 (-) 174 WP_080131484.1 competence pheromone ComX -
  KI219_RS08545 (RSC2_01786) - 1711804..1712685 (-) 882 WP_095292403.1 polyprenyl synthetase family protein -
  KI219_RS08550 (RSC2_01787) degQ 1712872..1713012 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  KI219_RS08555 - 1713624..1713845 (+) 222 WP_229029875.1 hypothetical protein -
  KI219_RS08560 (RSC2_01788) - 1713888..1715108 (-) 1221 WP_020452793.1 HDOD domain-containing protein -
  KI219_RS08565 (RSC2_01789) - 1715286..1716695 (-) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  KI219_RS08570 (RSC2_01790) - 1716773..1717324 (-) 552 WP_026580053.1 isochorismatase family cysteine hydrolase -
  KI219_RS08575 (RSC2_01791) - 1717510..1717911 (-) 402 WP_025809741.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=81355 KI219_RS08550 WP_003184860.1 1712872..1713012(-) (degQ) [Bacillus paralicheniformis strain RSC-2]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=81355 KI219_RS08550 WP_003184860.1 1712872..1713012(-) (degQ) [Bacillus paralicheniformis strain RSC-2]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment