Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KI219_RS04900 Genome accession   NZ_AP023089
Coordinates   1018496..1018672 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain RSC-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1013496..1023672
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KI219_RS04885 gcvT 1014138..1015231 (-) 1094 Protein_983 glycine cleavage system aminomethyltransferase GcvT -
  KI219_RS04890 (RSC2_01038) - 1015825..1017504 (+) 1680 WP_020452163.1 SNF2-related protein -
  KI219_RS04895 (RSC2_01039) - 1017511..1018305 (+) 795 WP_020452164.1 YqhG family protein -
  KI219_RS04900 (RSC2_01040) sinI 1018496..1018672 (+) 177 WP_023855184.1 anti-repressor SinI family protein Regulator
  KI219_RS04905 (RSC2_01041) sinR 1018706..1019041 (+) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  KI219_RS04910 (RSC2_01042) - 1019146..1019940 (-) 795 WP_020452167.1 TasA family protein -
  KI219_RS04915 (RSC2_01043) - 1020013..1020597 (-) 585 WP_020452168.1 signal peptidase I -
  KI219_RS21600 (RSC2_01044) - 1020594..1020824 (-) 231 WP_244834609.1 hypothetical protein -
  KI219_RS21605 (RSC2_01045) tapA 1020893..1021321 (-) 429 WP_244834611.1 amyloid fiber anchoring/assembly protein TapA -
  KI219_RS04925 (RSC2_01046) - 1021599..1021919 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  KI219_RS04930 (RSC2_01047) - 1021949..1022131 (-) 183 WP_020452171.1 YqzE family protein -
  KI219_RS04935 (RSC2_01048) comGG 1022220..1022585 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  KI219_RS04940 (RSC2_01049) comGF 1022597..1023085 (-) 489 WP_224067282.1 competence type IV pilus minor pilin ComGF -
  KI219_RS04945 (RSC2_01050) comGE 1022994..1023341 (-) 348 WP_023855191.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=81339 KI219_RS04900 WP_023855184.1 1018496..1018672(+) (sinI) [Bacillus paralicheniformis strain RSC-2]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=81339 KI219_RS04900 WP_023855184.1 1018496..1018672(+) (sinI) [Bacillus paralicheniformis strain RSC-2]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment