Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KI220_RS17715 Genome accession   NZ_AP023088
Coordinates   3587597..3587773 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain RSC-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3582597..3592773
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KI220_RS17700 (RSC1_03591) gcvT 3583238..3584332 (-) 1095 WP_023855182.1 glycine cleavage system aminomethyltransferase GcvT -
  KI220_RS17705 (RSC1_03592) - 3584927..3586606 (+) 1680 WP_020452163.1 SNF2-related protein -
  KI220_RS17710 (RSC1_03593) - 3586613..3587407 (+) 795 WP_020452164.1 YqhG family protein -
  KI220_RS17715 (RSC1_03594) sinI 3587597..3587773 (+) 177 WP_023855184.1 anti-repressor SinI family protein Regulator
  KI220_RS17720 (RSC1_03595) sinR 3587807..3588142 (+) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  KI220_RS17725 (RSC1_03596) - 3588247..3589041 (-) 795 WP_020452167.1 TasA family protein -
  KI220_RS17730 (RSC1_03597) - 3589114..3589698 (-) 585 WP_020452168.1 signal peptidase I -
  KI220_RS17735 (RSC1_03598) tapA 3589695..3590423 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  KI220_RS17740 (RSC1_03599) - 3590701..3591021 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  KI220_RS17745 (RSC1_03600) - 3591051..3591233 (-) 183 WP_020452171.1 YqzE family protein -
  KI220_RS17750 (RSC1_03601) comGG 3591322..3591687 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  KI220_RS17755 (RSC1_03602) comGF 3591699..3592187 (-) 489 WP_224067282.1 competence type IV pilus minor pilin ComGF -
  KI220_RS17760 (RSC1_03603) comGE 3592096..3592443 (-) 348 WP_023855191.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=81313 KI220_RS17715 WP_023855184.1 3587597..3587773(+) (sinI) [Bacillus paralicheniformis strain RSC-1]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=81313 KI220_RS17715 WP_023855184.1 3587597..3587773(+) (sinI) [Bacillus paralicheniformis strain RSC-1]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment