Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   QA586_RS05445 Genome accession   NZ_CP121527
Coordinates   1114530..1115105 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 1FSE01     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1068127..1114129 1114530..1115105 flank 401


Gene organization within MGE regions


Location: 1068127..1115105
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QA586_RS05100 - 1068256..1068597 (-) 342 WP_002456621.1 fatty acid desaturase -
  QA586_RS05105 - 1068810..1069046 (-) 237 WP_001829451.1 hypothetical protein -
  QA586_RS11980 - 1069248..1069499 (-) 252 WP_001829448.1 plasmid recombination protein -
  QA586_RS11985 - 1069581..1069808 (-) 228 WP_080033396.1 plasmid recombination protein -
  QA586_RS05115 - 1070864..1072327 (-) 1464 WP_196308507.1 SH3 domain-containing protein -
  QA586_RS05120 - 1072302..1072712 (-) 411 WP_196308506.1 phage holin -
  QA586_RS05125 - 1072776..1073174 (-) 399 WP_002500087.1 YxeA family protein -
  QA586_RS05130 - 1073302..1073448 (-) 147 WP_002493359.1 XkdX family protein -
  QA586_RS05135 - 1073441..1073776 (-) 336 WP_203352742.1 hypothetical protein -
  QA586_RS05140 - 1073788..1075446 (-) 1659 WP_203352741.1 BppU family phage baseplate upper protein -
  QA586_RS05145 - 1075499..1077379 (-) 1881 WP_237637515.1 glucosaminidase domain-containing protein -
  QA586_RS05150 - 1077433..1077831 (-) 399 WP_237637522.1 hypothetical protein -
  QA586_RS05155 - 1077812..1078234 (-) 423 WP_237637516.1 hypothetical protein -
  QA586_RS05160 - 1078248..1079435 (-) 1188 WP_237637517.1 BppU family phage baseplate upper protein -
  QA586_RS05165 - 1079451..1081334 (-) 1884 WP_237637518.1 M14 family metallopeptidase -
  QA586_RS05170 - 1081337..1082797 (-) 1461 WP_203352735.1 phage tail protein -
  QA586_RS05175 - 1082809..1083765 (-) 957 WP_123985723.1 phage tail domain-containing protein -
  QA586_RS05180 - 1083777..1087706 (-) 3930 WP_203352734.1 phage tail protein -
  QA586_RS05185 - 1087721..1088065 (-) 345 WP_203352733.1 hypothetical protein -
  QA586_RS05190 - 1088107..1088466 (-) 360 WP_016898274.1 tail assembly chaperone -
  QA586_RS05195 - 1088531..1089085 (-) 555 WP_002475496.1 phage major tail protein, TP901-1 family -
  QA586_RS05200 - 1089129..1089518 (-) 390 WP_049401181.1 hypothetical protein -
  QA586_RS05205 - 1089518..1089880 (-) 363 WP_002493374.1 HK97-gp10 family putative phage morphogenesis protein -
  QA586_RS05210 - 1089880..1090182 (-) 303 WP_161375729.1 hypothetical protein -
  QA586_RS05215 - 1090179..1090508 (-) 330 WP_002475600.1 phage head-tail connector protein -
  QA586_RS05220 - 1090510..1090779 (-) 270 WP_203352732.1 hypothetical protein -
  QA586_RS05225 - 1090800..1091729 (-) 930 WP_195212721.1 phage major capsid protein -
  QA586_RS05230 - 1091745..1092350 (-) 606 WP_002475594.1 DUF4355 domain-containing protein -
  QA586_RS05235 - 1092609..1092761 (-) 153 WP_203352788.1 hypothetical protein -
  QA586_RS05240 - 1092745..1093293 (-) 549 WP_203352731.1 hypothetical protein -
  QA586_RS05245 - 1093307..1094245 (-) 939 WP_203352730.1 minor capsid protein -
  QA586_RS05250 - 1094252..1095781 (-) 1530 WP_203352729.1 phage portal protein -
  QA586_RS05255 - 1095793..1097091 (-) 1299 WP_203352728.1 PBSX family phage terminase large subunit -
  QA586_RS05260 - 1097084..1097509 (-) 426 WP_203352785.1 terminase small subunit -
  QA586_RS05265 - 1097588..1098169 (-) 582 WP_203352727.1 hypothetical protein -
  QA586_RS05270 - 1098381..1098647 (-) 267 WP_203352726.1 hypothetical protein -
  QA586_RS05275 - 1098659..1099078 (-) 420 WP_203352725.1 transcriptional regulator -
  QA586_RS05280 - 1099097..1099315 (-) 219 WP_203352724.1 hypothetical protein -
  QA586_RS05285 - 1099333..1099554 (-) 222 WP_099816437.1 hypothetical protein -
  QA586_RS05290 - 1099630..1099806 (-) 177 WP_203352723.1 transcriptional regulator -
  QA586_RS05295 - 1099862..1100239 (-) 378 WP_203352722.1 hypothetical protein -
  QA586_RS05300 - 1100290..1100805 (-) 516 WP_203352721.1 dUTP pyrophosphatase -
  QA586_RS05305 - 1100806..1100985 (-) 180 WP_203352720.1 hypothetical protein -
  QA586_RS05310 - 1100986..1101123 (-) 138 WP_168992853.1 hypothetical protein -
  QA586_RS05315 - 1101116..1101370 (-) 255 WP_278276472.1 hypothetical protein -
  QA586_RS05320 - 1101373..1101726 (-) 354 WP_203352718.1 thermonuclease family protein -
  QA586_RS05325 - 1101757..1102020 (-) 264 WP_195212703.1 hypothetical protein -
  QA586_RS05330 - 1102010..1102423 (-) 414 WP_203352717.1 DUF1064 domain-containing protein -
  QA586_RS05335 - 1102463..1103359 (-) 897 Protein_1013 DnaD domain protein -
  QA586_RS05340 ssbA 1103389..1103862 (-) 474 WP_203352715.1 single-stranded DNA-binding protein Machinery gene
  QA586_RS05345 - 1103863..1104480 (-) 618 WP_237632725.1 MBL fold metallo-hydrolase -
  QA586_RS05350 - 1104561..1105484 (-) 924 WP_203352714.1 recombinase RecT -
  QA586_RS05355 - 1105486..1107438 (-) 1953 WP_203352713.1 AAA family ATPase -
  QA586_RS05360 - 1107507..1107683 (-) 177 WP_203352712.1 hypothetical protein -
  QA586_RS05365 - 1107758..1107925 (-) 168 WP_186311563.1 hypothetical protein -
  QA586_RS05370 - 1107939..1108148 (-) 210 WP_001830281.1 hypothetical protein -
  QA586_RS05375 - 1108204..1108392 (+) 189 WP_203352711.1 hypothetical protein -
  QA586_RS05380 - 1108397..1108480 (-) 84 Protein_1022 hypothetical protein -
  QA586_RS05385 - 1108482..1108649 (-) 168 WP_172969456.1 hypothetical protein -
  QA586_RS05390 - 1108675..1109394 (-) 720 WP_203352710.1 BRO family protein -
  QA586_RS05395 - 1109532..1109777 (-) 246 WP_049388199.1 helix-turn-helix transcriptional regulator -
  QA586_RS05400 - 1109943..1110257 (+) 315 WP_203352709.1 helix-turn-helix transcriptional regulator -
  QA586_RS05405 - 1110270..1110722 (+) 453 WP_203352708.1 ImmA/IrrE family metallo-endopeptidase -
  QA586_RS05410 - 1110726..1111250 (+) 525 WP_203352707.1 hypothetical protein -
  QA586_RS05415 - 1111252..1111836 (+) 585 WP_070857133.1 hypothetical protein -
  QA586_RS05420 - 1111905..1112795 (+) 891 WP_032606348.1 hypothetical protein -
  QA586_RS05425 - 1112806..1112985 (-) 180 WP_032606349.1 hypothetical protein -
  QA586_RS05430 - 1113080..1114129 (+) 1050 WP_032606350.1 site-specific integrase -
  QA586_RS05445 comK/comK1 1114530..1115105 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=812797 QA586_RS05445 WP_001829272.1 1114530..1115105(-) (comK/comK1) [Staphylococcus epidermidis strain 1FSE01]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=812797 QA586_RS05445 WP_001829272.1 1114530..1115105(-) (comK/comK1) [Staphylococcus epidermidis strain 1FSE01]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains


Predicted by InterproScan.

(7-158)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743

  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743