Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   QA593_RS09245 Genome accession   NZ_CP121522
Coordinates   1968210..1968785 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 1DSE05     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1931915..1967673 1968210..1968785 flank 537


Gene organization within MGE regions


Location: 1931915..1968785
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QA593_RS09020 - 1931915..1932835 (-) 921 WP_002501737.1 peptidoglycan recognition family protein -
  QA593_RS09025 - 1932888..1933274 (-) 387 WP_002446772.1 phage holin family protein -
  QA593_RS09030 - 1933276..1933557 (-) 282 WP_002501736.1 hypothetical protein -
  QA593_RS09035 - 1933594..1934004 (-) 411 WP_002501735.1 hypothetical protein -
  QA593_RS09040 - 1934025..1937480 (-) 3456 WP_002501734.1 phage tail spike protein -
  QA593_RS09045 - 1937477..1938247 (-) 771 WP_049392193.1 tail protein -
  QA593_RS09050 - 1938250..1942431 (-) 4182 WP_002501731.1 phage tail tape measure protein -
  QA593_RS09055 - 1942495..1942695 (-) 201 WP_002501730.1 hypothetical protein -
  QA593_RS09060 - 1942761..1943105 (-) 345 WP_002501729.1 hypothetical protein -
  QA593_RS09065 - 1943129..1943833 (-) 705 WP_002484613.1 hypothetical protein -
  QA593_RS09070 - 1943839..1944276 (-) 438 WP_002501727.1 hypothetical protein -
  QA593_RS09075 - 1944276..1944614 (-) 339 WP_002501726.1 hypothetical protein -
  QA593_RS09080 - 1944614..1944943 (-) 330 WP_002501725.1 phage head closure protein -
  QA593_RS09085 - 1944915..1945223 (-) 309 WP_002484579.1 phage head-tail connector protein -
  QA593_RS09090 - 1945250..1946407 (-) 1158 WP_002501724.1 phage major capsid protein -
  QA593_RS09095 - 1946432..1947178 (-) 747 WP_002501723.1 head maturation protease, ClpP-related -
  QA593_RS09100 - 1947178..1948314 (-) 1137 WP_002501722.1 phage portal protein -
  QA593_RS09105 - 1948330..1949964 (-) 1635 WP_002501721.1 terminase TerL endonuclease subunit -
  QA593_RS09110 - 1949948..1950286 (-) 339 WP_002501720.1 hypothetical protein -
  QA593_RS09115 - 1950605..1950895 (-) 291 WP_002501719.1 HNH endonuclease -
  QA593_RS09120 - 1951178..1951789 (-) 612 WP_002501718.1 hypothetical protein -
  QA593_RS09125 - 1951993..1952484 (-) 492 WP_002501717.1 sigma factor-like helix-turn-helix DNA-binding protein -
  QA593_RS09130 - 1952808..1954682 (-) 1875 WP_002501716.1 DNA primase family protein -
  QA593_RS09135 - 1954712..1954906 (-) 195 WP_002501715.1 hypothetical protein -
  QA593_RS09140 - 1954985..1955230 (-) 246 WP_002501714.1 hypothetical protein -
  QA593_RS09145 - 1955302..1955517 (+) 216 WP_002491630.1 hypothetical protein -
  QA593_RS09150 - 1955535..1955837 (-) 303 WP_002501713.1 MazG-like family protein -
  QA593_RS09155 - 1955903..1956598 (+) 696 WP_002501712.1 hypothetical protein -
  QA593_RS09160 - 1956606..1956995 (-) 390 WP_002501711.1 hypothetical protein -
  QA593_RS09165 - 1957251..1958969 (-) 1719 WP_002501710.1 hypothetical protein -
  QA593_RS09170 - 1959019..1959501 (-) 483 WP_002501709.1 DUF669 domain-containing protein -
  QA593_RS09175 - 1959553..1959759 (-) 207 WP_002501708.1 hypothetical protein -
  QA593_RS09180 - 1959778..1961589 (-) 1812 WP_002501707.1 AAA family ATPase -
  QA593_RS09185 - 1961589..1961885 (-) 297 WP_002484599.1 hypothetical protein -
  QA593_RS09190 - 1961878..1962195 (-) 318 WP_002501706.1 hypothetical protein -
  QA593_RS09195 - 1962198..1963439 (-) 1242 WP_002501705.1 SNF2-related protein -
  QA593_RS09200 - 1963587..1963781 (-) 195 WP_002491611.1 DUF1270 family protein -
  QA593_RS09205 - 1964266..1964574 (-) 309 WP_002501703.1 DUF771 domain-containing protein -
  QA593_RS09210 - 1964628..1964819 (-) 192 WP_002501702.1 helix-turn-helix transcriptional regulator -
  QA593_RS09215 - 1964980..1965315 (+) 336 WP_002446811.1 helix-turn-helix transcriptional regulator -
  QA593_RS09220 - 1965471..1965845 (+) 375 WP_002501701.1 hypothetical protein -
  QA593_RS09225 - 1965858..1966532 (+) 675 WP_049392317.1 Ltp family lipoprotein -
  QA593_RS09230 - 1966609..1967673 (+) 1065 WP_002491600.1 site-specific integrase -
  QA593_RS09245 comK/comK1 1968210..1968785 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=812735 QA593_RS09245 WP_001829272.1 1968210..1968785(-) (comK/comK1) [Staphylococcus epidermidis strain 1DSE05]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=812735 QA593_RS09245 WP_001829272.1 1968210..1968785(-) (comK/comK1) [Staphylococcus epidermidis strain 1DSE05]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains


Predicted by InterproScan.

(7-158)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743

  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743