Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   P9972_RS15190 Genome accession   NZ_CP121465
Coordinates   3076494..3076634 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain YA215     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3071494..3081634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P9972_RS15165 (P9972_15165) - 3071791..3072174 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  P9972_RS15170 (P9972_15170) comA 3072196..3072840 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  P9972_RS15175 (P9972_15175) comP 3072921..3075224 (-) 2304 WP_207579565.1 histidine kinase Regulator
  P9972_RS15180 (P9972_15180) comX 3075244..3075423 (-) 180 WP_306383677.1 competence pheromone ComX -
  P9972_RS15185 (P9972_15185) comQ 3075377..3076363 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  P9972_RS15190 (P9972_15190) degQ 3076494..3076634 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  P9972_RS15195 (P9972_15195) - 3077100..3077441 (+) 342 WP_046560014.1 hypothetical protein -
  P9972_RS15200 (P9972_15200) - 3077448..3078668 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  P9972_RS15205 (P9972_15205) - 3078798..3080264 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  P9972_RS15210 (P9972_15210) - 3080282..3080833 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  P9972_RS15215 (P9972_15215) - 3080930..3081328 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=812181 P9972_RS15190 WP_003152043.1 3076494..3076634(-) (degQ) [Bacillus velezensis strain YA215]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=812181 P9972_RS15190 WP_003152043.1 3076494..3076634(-) (degQ) [Bacillus velezensis strain YA215]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891