Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | P9972_RS15190 | Genome accession | NZ_CP121465 |
| Coordinates | 3076494..3076634 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain YA215 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3071494..3081634
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9972_RS15165 (P9972_15165) | - | 3071791..3072174 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| P9972_RS15170 (P9972_15170) | comA | 3072196..3072840 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| P9972_RS15175 (P9972_15175) | comP | 3072921..3075224 (-) | 2304 | WP_207579565.1 | histidine kinase | Regulator |
| P9972_RS15180 (P9972_15180) | comX | 3075244..3075423 (-) | 180 | WP_306383677.1 | competence pheromone ComX | - |
| P9972_RS15185 (P9972_15185) | comQ | 3075377..3076363 (-) | 987 | WP_269321599.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| P9972_RS15190 (P9972_15190) | degQ | 3076494..3076634 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| P9972_RS15195 (P9972_15195) | - | 3077100..3077441 (+) | 342 | WP_046560014.1 | hypothetical protein | - |
| P9972_RS15200 (P9972_15200) | - | 3077448..3078668 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| P9972_RS15205 (P9972_15205) | - | 3078798..3080264 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| P9972_RS15210 (P9972_15210) | - | 3080282..3080833 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| P9972_RS15215 (P9972_15215) | - | 3080930..3081328 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=812181 P9972_RS15190 WP_003152043.1 3076494..3076634(-) (degQ) [Bacillus velezensis strain YA215]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=812181 P9972_RS15190 WP_003152043.1 3076494..3076634(-) (degQ) [Bacillus velezensis strain YA215]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |