Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P9972_RS12185 Genome accession   NZ_CP121465
Coordinates   2508801..2508974 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain YA215     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2503801..2513974
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P9972_RS12170 (P9972_12170) gcvT 2504618..2505718 (-) 1101 WP_207579557.1 glycine cleavage system aminomethyltransferase GcvT -
  P9972_RS12175 (P9972_12175) - 2506142..2507812 (+) 1671 WP_003153107.1 SNF2-related protein -
  P9972_RS12180 (P9972_12180) - 2507830..2508624 (+) 795 WP_003153106.1 YqhG family protein -
  P9972_RS12185 (P9972_12185) sinI 2508801..2508974 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  P9972_RS12190 (P9972_12190) sinR 2509008..2509343 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P9972_RS12195 (P9972_12195) - 2509391..2510176 (-) 786 WP_003153102.1 TasA family protein -
  P9972_RS12200 (P9972_12200) - 2510240..2510824 (-) 585 WP_046559873.1 signal peptidase I -
  P9972_RS12205 (P9972_12205) tapA 2510796..2511467 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  P9972_RS12210 (P9972_12210) - 2511726..2512055 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  P9972_RS12215 (P9972_12215) - 2512095..2512274 (-) 180 WP_003153093.1 YqzE family protein -
  P9972_RS12220 (P9972_12220) comGG 2512331..2512708 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  P9972_RS12225 (P9972_12225) comGF 2512709..2513104 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  P9972_RS12230 (P9972_12230) comGE 2513118..2513432 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  P9972_RS12235 (P9972_12235) comGD 2513416..2513853 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=812158 P9972_RS12185 WP_003153105.1 2508801..2508974(+) (sinI) [Bacillus velezensis strain YA215]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=812158 P9972_RS12185 WP_003153105.1 2508801..2508974(+) (sinI) [Bacillus velezensis strain YA215]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702