Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | P9972_RS12185 | Genome accession | NZ_CP121465 |
| Coordinates | 2508801..2508974 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain YA215 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2503801..2513974
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9972_RS12170 (P9972_12170) | gcvT | 2504618..2505718 (-) | 1101 | WP_207579557.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| P9972_RS12175 (P9972_12175) | - | 2506142..2507812 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| P9972_RS12180 (P9972_12180) | - | 2507830..2508624 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| P9972_RS12185 (P9972_12185) | sinI | 2508801..2508974 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| P9972_RS12190 (P9972_12190) | sinR | 2509008..2509343 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| P9972_RS12195 (P9972_12195) | - | 2509391..2510176 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| P9972_RS12200 (P9972_12200) | - | 2510240..2510824 (-) | 585 | WP_046559873.1 | signal peptidase I | - |
| P9972_RS12205 (P9972_12205) | tapA | 2510796..2511467 (-) | 672 | WP_046559874.1 | amyloid fiber anchoring/assembly protein TapA | - |
| P9972_RS12210 (P9972_12210) | - | 2511726..2512055 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| P9972_RS12215 (P9972_12215) | - | 2512095..2512274 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| P9972_RS12220 (P9972_12220) | comGG | 2512331..2512708 (-) | 378 | WP_046559875.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| P9972_RS12225 (P9972_12225) | comGF | 2512709..2513104 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| P9972_RS12230 (P9972_12230) | comGE | 2513118..2513432 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| P9972_RS12235 (P9972_12235) | comGD | 2513416..2513853 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=812158 P9972_RS12185 WP_003153105.1 2508801..2508974(+) (sinI) [Bacillus velezensis strain YA215]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=812158 P9972_RS12185 WP_003153105.1 2508801..2508974(+) (sinI) [Bacillus velezensis strain YA215]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |