Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   P9972_RS12230 Genome accession   NZ_CP121465
Coordinates   2513118..2513432 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain YA215     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2508118..2518432
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P9972_RS12185 (P9972_12185) sinI 2508801..2508974 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  P9972_RS12190 (P9972_12190) sinR 2509008..2509343 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P9972_RS12195 (P9972_12195) - 2509391..2510176 (-) 786 WP_003153102.1 TasA family protein -
  P9972_RS12200 (P9972_12200) - 2510240..2510824 (-) 585 WP_046559873.1 signal peptidase I -
  P9972_RS12205 (P9972_12205) tapA 2510796..2511467 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  P9972_RS12210 (P9972_12210) - 2511726..2512055 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  P9972_RS12215 (P9972_12215) - 2512095..2512274 (-) 180 WP_003153093.1 YqzE family protein -
  P9972_RS12220 (P9972_12220) comGG 2512331..2512708 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  P9972_RS12225 (P9972_12225) comGF 2512709..2513104 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  P9972_RS12230 (P9972_12230) comGE 2513118..2513432 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  P9972_RS12235 (P9972_12235) comGD 2513416..2513853 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  P9972_RS12240 (P9972_12240) comGC 2513843..2514151 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  P9972_RS12245 (P9972_12245) comGB 2514156..2515193 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  P9972_RS12250 (P9972_12250) comGA 2515180..2516250 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  P9972_RS12255 (P9972_12255) - 2516442..2517392 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=812161 P9972_RS12230 WP_015388003.1 2513118..2513432(-) (comGE) [Bacillus velezensis strain YA215]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=812161 P9972_RS12230 WP_015388003.1 2513118..2513432(-) (comGE) [Bacillus velezensis strain YA215]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481