Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P8R49_RS12745 Genome accession   NZ_CP121266
Coordinates   2369741..2369914 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain 107105     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2364741..2374914
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P8R49_RS12730 (P8R49_12730) gcvT 2365540..2366628 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  P8R49_RS12735 (P8R49_12735) hepAA 2367070..2368743 (+) 1674 WP_014480248.1 SNF2-related protein -
  P8R49_RS12740 (P8R49_12740) yqhG 2368764..2369558 (+) 795 WP_014480249.1 YqhG family protein -
  P8R49_RS12745 (P8R49_12745) sinI 2369741..2369914 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  P8R49_RS12750 (P8R49_12750) sinR 2369948..2370283 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P8R49_RS12755 (P8R49_12755) tasA 2370376..2371161 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  P8R49_RS12760 (P8R49_12760) sipW 2371225..2371797 (-) 573 WP_003230181.1 signal peptidase I SipW -
  P8R49_RS12765 (P8R49_12765) tapA 2371781..2372542 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  P8R49_RS12770 (P8R49_12770) yqzG 2372814..2373140 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  P8R49_RS12775 (P8R49_12775) spoIITA 2373182..2373361 (-) 180 WP_014480252.1 YqzE family protein -
  P8R49_RS12780 (P8R49_12780) comGG 2373432..2373806 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  P8R49_RS12785 (P8R49_12785) comGF 2373807..2374190 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  P8R49_RS12790 (P8R49_12790) comGE 2374216..2374563 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=811514 P8R49_RS12745 WP_003230187.1 2369741..2369914(+) (sinI) [Bacillus subtilis strain 107105]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=811514 P8R49_RS12745 WP_003230187.1 2369741..2369914(+) (sinI) [Bacillus subtilis strain 107105]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1