Detailed information
Overview
| Name | rcrR | Type | Regulator |
| Locus tag | P7Y79_RS03795 | Genome accession | NZ_CP121207 |
| Coordinates | 790025..790465 (+) | Length | 146 a.a. |
| NCBI ID | WP_006531250.1 | Uniprot ID | A0A380KQ77 |
| Organism | Streptococcus ruminicola strain CNU_77-47 | ||
| Function | regulate competence (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 776017..807512 | 790025..790465 | within | 0 |
Gene organization within MGE regions
Location: 776017..807512
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7Y79_RS03730 (P7Y79_03730) | - | 776017..777222 (+) | 1206 | WP_278007752.1 | CCA tRNA nucleotidyltransferase | - |
| P7Y79_RS03735 (P7Y79_03735) | - | 777219..779087 (+) | 1869 | WP_278007753.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| P7Y79_RS03740 (P7Y79_03740) | - | 779129..780868 (+) | 1740 | WP_278007754.1 | ABC transporter ATP-binding protein | - |
| P7Y79_RS03745 (P7Y79_03745) | - | 780871..782640 (+) | 1770 | WP_278007755.1 | ABC transporter ATP-binding protein | - |
| P7Y79_RS03750 (P7Y79_03750) | queC | 782807..783457 (+) | 651 | WP_074867853.1 | 7-cyano-7-deazaguanine synthase QueC | - |
| P7Y79_RS03755 (P7Y79_03755) | queD | 783457..783903 (+) | 447 | WP_278007756.1 | 6-carboxytetrahydropterin synthase QueD | - |
| P7Y79_RS03760 (P7Y79_03760) | queE | 783896..784609 (+) | 714 | WP_278007757.1 | 7-carboxy-7-deazaguanine synthase QueE | - |
| P7Y79_RS03765 (P7Y79_03765) | queF | 784758..785249 (+) | 492 | WP_039696752.1 | preQ(1) synthase | - |
| P7Y79_RS03770 (P7Y79_03770) | - | 785323..786674 (+) | 1352 | WP_278007758.1 | IS3 family transposase | - |
| P7Y79_RS03775 (P7Y79_03775) | - | 786725..787222 (-) | 498 | WP_039696754.1 | DUF308 domain-containing protein | - |
| P7Y79_RS03780 (P7Y79_03780) | gdhA | 787459..788808 (+) | 1350 | WP_278007759.1 | NADP-specific glutamate dehydrogenase | - |
| P7Y79_RS03785 (P7Y79_03785) | - | 788965..789474 (+) | 510 | WP_157629111.1 | GNAT family N-acetyltransferase | - |
| P7Y79_RS03790 (P7Y79_03790) | - | 789471..789881 (+) | 411 | WP_278007760.1 | peptide deformylase | - |
| P7Y79_RS03795 (P7Y79_03795) | rcrR | 790025..790465 (+) | 441 | WP_006531250.1 | MarR family transcriptional regulator | Regulator |
| P7Y79_RS03800 (P7Y79_03800) | rcrP | 790469..792283 (+) | 1815 | WP_278007761.1 | ABC transporter ATP-binding protein | Regulator |
| P7Y79_RS03805 (P7Y79_03805) | rcrQ | 792273..794045 (+) | 1773 | WP_278007762.1 | ABC transporter ATP-binding protein | Regulator |
| P7Y79_RS03810 (P7Y79_03810) | - | 794145..794780 (+) | 636 | WP_278007763.1 | GTP pyrophosphokinase family protein | - |
| P7Y79_RS03815 (P7Y79_03815) | - | 794783..795463 (+) | 681 | WP_039696761.1 | response regulator transcription factor | - |
| P7Y79_RS03820 (P7Y79_03820) | - | 795472..796698 (+) | 1227 | WP_278007764.1 | HAMP domain-containing sensor histidine kinase | - |
| P7Y79_RS03825 (P7Y79_03825) | - | 796743..797588 (-) | 846 | WP_278007765.1 | aldo/keto reductase | - |
| P7Y79_RS03830 (P7Y79_03830) | - | 797654..798568 (-) | 915 | WP_074626696.1 | LysR family transcriptional regulator | - |
| P7Y79_RS03835 (P7Y79_03835) | - | 799149..800174 (+) | 1026 | WP_278007766.1 | uroporphyrinogen decarboxylase family protein | - |
| P7Y79_RS03840 (P7Y79_03840) | - | 800235..801113 (+) | 879 | WP_093814661.1 | transporter substrate-binding domain-containing protein | - |
| P7Y79_RS03845 (P7Y79_03845) | - | 801123..801815 (+) | 693 | WP_278007767.1 | amino acid ABC transporter permease | - |
| P7Y79_RS03850 (P7Y79_03850) | - | 801826..802509 (+) | 684 | WP_074867818.1 | ABC transporter permease subunit | - |
| P7Y79_RS03855 (P7Y79_03855) | - | 802525..803283 (+) | 759 | WP_157629102.1 | amino acid ABC transporter ATP-binding protein | - |
| P7Y79_RS03860 (P7Y79_03860) | - | 803504..804187 (+) | 684 | WP_039696770.1 | amino acid ABC transporter permease | - |
| P7Y79_RS03865 (P7Y79_03865) | - | 804147..804824 (+) | 678 | WP_157629101.1 | amino acid ABC transporter permease | - |
| P7Y79_RS03870 (P7Y79_03870) | - | 804830..805576 (+) | 747 | WP_274641809.1 | amino acid ABC transporter ATP-binding protein | - |
| P7Y79_RS03875 (P7Y79_03875) | - | 805606..806478 (+) | 873 | WP_021142447.1 | cysteine ABC transporter substrate-binding protein | - |
| P7Y79_RS03880 (P7Y79_03880) | mvk | 806634..807512 (+) | 879 | WP_166044294.1 | mevalonate kinase | - |
Sequence
Protein
Download Length: 146 a.a. Molecular weight: 17108.62 Da Isoelectric Point: 8.4635
>NTDB_id=811096 P7Y79_RS03795 WP_006531250.1 790025..790465(+) (rcrR) [Streptococcus ruminicola strain CNU_77-47]
MRDKDPFSQFRYFINLMENRVHELGEQHGVENLAGPQGFAVLYLRENEDKEVFIKDIERKLKISKSVTSNLIKRMEKNGF
IEVVPSEVDKRYKRVVLTELGKAKSKDIDAFHTAIHKQIFDGISREELEISGRVFDRILKNLENKE
MRDKDPFSQFRYFINLMENRVHELGEQHGVENLAGPQGFAVLYLRENEDKEVFIKDIERKLKISKSVTSNLIKRMEKNGF
IEVVPSEVDKRYKRVVLTELGKAKSKDIDAFHTAIHKQIFDGISREELEISGRVFDRILKNLENKE
Nucleotide
Download Length: 441 bp
>NTDB_id=811096 P7Y79_RS03795 WP_006531250.1 790025..790465(+) (rcrR) [Streptococcus ruminicola strain CNU_77-47]
ATGCGAGACAAAGATCCGTTTTCACAATTTAGATACTTTATTAATTTGATGGAGAATCGGGTACATGAGCTCGGTGAGCA
GCATGGTGTTGAAAATCTCGCTGGTCCGCAGGGTTTTGCAGTTCTTTATTTACGTGAAAATGAAGACAAGGAAGTTTTCA
TCAAGGACATTGAACGTAAGCTTAAGATTTCAAAATCTGTGACCAGTAATTTGATTAAGCGAATGGAGAAGAATGGCTTT
ATTGAGGTGGTTCCGTCAGAGGTTGATAAGCGTTATAAGCGTGTCGTCTTGACTGAGCTGGGCAAAGCAAAATCCAAAGA
CATCGATGCTTTTCATACTGCTATTCATAAACAAATTTTTGATGGTATTAGCCGTGAAGAACTAGAAATTTCTGGTCGTG
TCTTTGATCGCATTTTGAAAAACTTAGAAAACAAGGAGTAA
ATGCGAGACAAAGATCCGTTTTCACAATTTAGATACTTTATTAATTTGATGGAGAATCGGGTACATGAGCTCGGTGAGCA
GCATGGTGTTGAAAATCTCGCTGGTCCGCAGGGTTTTGCAGTTCTTTATTTACGTGAAAATGAAGACAAGGAAGTTTTCA
TCAAGGACATTGAACGTAAGCTTAAGATTTCAAAATCTGTGACCAGTAATTTGATTAAGCGAATGGAGAAGAATGGCTTT
ATTGAGGTGGTTCCGTCAGAGGTTGATAAGCGTTATAAGCGTGTCGTCTTGACTGAGCTGGGCAAAGCAAAATCCAAAGA
CATCGATGCTTTTCATACTGCTATTCATAAACAAATTTTTGATGGTATTAGCCGTGAAGAACTAGAAATTTCTGGTCGTG
TCTTTGATCGCATTTTGAAAAACTTAGAAAACAAGGAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| rcrR | Streptococcus mutans UA159 |
54.545 |
97.945 |
0.534 |