Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   P8F80_RS00045 Genome accession   NZ_CP121161
Coordinates   10300..10854 (+) Length   184 a.a.
NCBI ID   WP_112193831.1    Uniprot ID   A0A2Z4VY05
Organism   Ligilactobacillus murinus strain PC39     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1522..45875 10300..10854 within 0


Gene organization within MGE regions


Location: 1522..45875
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P8F80_RS00010 (P8F80_00010) dnaN 1522..2661 (+) 1140 WP_004049713.1 DNA polymerase III subunit beta -
  P8F80_RS00015 (P8F80_00015) yaaA 2910..3134 (+) 225 WP_004049711.1 S4 domain-containing protein YaaA -
  P8F80_RS00020 (P8F80_00020) recF 3143..4360 (+) 1218 WP_135942272.1 DNA replication/repair protein RecF -
  P8F80_RS00025 (P8F80_00025) gyrB 4381..6339 (+) 1959 WP_004049707.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  P8F80_RS00030 (P8F80_00030) gyrA 6437..8899 (+) 2463 WP_004049705.1 DNA gyrase subunit A -
  P8F80_RS00035 (P8F80_00035) - 8996..9631 (-) 636 WP_326516389.1 NAD(P)-dependent oxidoreductase -
  P8F80_RS00040 (P8F80_00040) rpsF 9973..10263 (+) 291 WP_004049701.1 30S ribosomal protein S6 -
  P8F80_RS00045 (P8F80_00045) ssb 10300..10854 (+) 555 WP_112193831.1 single-stranded DNA-binding protein Machinery gene
  P8F80_RS00050 (P8F80_00050) rpsR 10876..11112 (+) 237 WP_003695889.1 30S ribosomal protein S18 -
  P8F80_RS00055 (P8F80_00055) - 11182..11709 (+) 528 WP_004047940.1 helix-turn-helix domain-containing protein -
  P8F80_RS00060 (P8F80_00060) - 11694..12569 (+) 876 WP_326516802.1 IS3 family transposase -
  P8F80_RS00065 (P8F80_00065) - 13067..14029 (-) 963 WP_326516031.1 IS30 family transposase -
  P8F80_RS00070 (P8F80_00070) - 14242..14772 (-) 531 WP_326516390.1 hypothetical protein -
  P8F80_RS00075 (P8F80_00075) - 14933..15139 (+) 207 WP_004049696.1 hypothetical protein -
  P8F80_RS00080 (P8F80_00080) - 15153..16841 (-) 1689 WP_326516391.1 IS1182 family transposase -
  P8F80_RS00085 (P8F80_00085) - 17030..18013 (-) 984 WP_004049689.1 DUF1002 domain-containing protein -
  P8F80_RS00090 (P8F80_00090) tnpA 18139..18594 (-) 456 WP_004050858.1 IS200/IS605 family transposase -
  P8F80_RS00095 (P8F80_00095) - 18668..19918 (+) 1251 WP_004050805.1 RNA-guided endonuclease InsQ/TnpB family protein -
  P8F80_RS00100 (P8F80_00100) pnuC 20299..21069 (+) 771 WP_326516392.1 nicotinamide riboside transporter PnuC -
  P8F80_RS00105 (P8F80_00105) - 21311..23326 (+) 2016 WP_326516393.1 DHH family phosphoesterase -
  P8F80_RS00110 (P8F80_00110) rplI 23354..23803 (+) 450 WP_004049682.1 50S ribosomal protein L9 -
  P8F80_RS00115 (P8F80_00115) - 23913..24626 (+) 714 WP_276507777.1 helix-turn-helix domain-containing protein -
  P8F80_RS00120 (P8F80_00120) - 24563..25474 (+) 912 WP_112193163.1 IS3 family transposase -
  P8F80_RS00125 (P8F80_00125) - 25585..26100 (-) 516 WP_326516394.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
  P8F80_RS00130 (P8F80_00130) - 26090..27193 (-) 1104 WP_326516395.1 hypothetical protein -
  P8F80_RS00135 (P8F80_00135) - 27183..27830 (-) 648 WP_326516396.1 L-threonylcarbamoyladenylate synthase -
  P8F80_RS00140 (P8F80_00140) - 27818..28957 (-) 1140 WP_326516397.1 LeuA family protein -
  P8F80_RS00145 (P8F80_00145) - 29083..29970 (+) 888 WP_076149716.1 LysR family transcriptional regulator -
  P8F80_RS00150 (P8F80_00150) - 30221..31105 (-) 885 WP_326516398.1 LysR family transcriptional regulator -
  P8F80_RS00155 (P8F80_00155) - 31228..32148 (+) 921 WP_326516399.1 DMT family transporter -
  P8F80_RS00160 (P8F80_00160) - 32206..32970 (-) 765 WP_135056039.1 LytR/AlgR family response regulator transcription factor -
  P8F80_RS00165 (P8F80_00165) - 32964..34292 (-) 1329 WP_326516400.1 GHKL domain-containing protein -
  P8F80_RS00170 (P8F80_00170) - 34844..36016 (+) 1173 WP_004047661.1 IS256 family transposase -
  P8F80_RS00175 (P8F80_00175) - 36066..36326 (-) 261 WP_326516401.1 hypothetical protein -
  P8F80_RS00180 (P8F80_00180) - 36364..37191 (-) 828 WP_326516402.1 ABC transporter ATP-binding protein -
  P8F80_RS12370 - 37363..37575 (-) 213 WP_148458451.1 LPXTG cell wall anchor domain-containing protein -
  P8F80_RS12375 - 37496..37696 (+) 201 Protein_37 IS30 family transposase -
  P8F80_RS00185 (P8F80_00185) - 38073..38285 (-) 213 WP_004049671.1 hypothetical protein -
  P8F80_RS12380 - 38328..38399 (-) 72 Protein_39 ATP-binding cassette domain-containing protein -
  P8F80_RS00190 (P8F80_00190) - 38527..38949 (+) 423 WP_326516403.1 hypothetical protein -
  P8F80_RS12385 - 39187..39411 (+) 225 WP_148458531.1 4'-phosphopantetheinyl transferase family protein -
  P8F80_RS00195 (P8F80_00195) - 39535..40161 (-) 627 WP_148458519.1 LexA family protein -
  P8F80_RS00200 (P8F80_00200) - 40308..40514 (+) 207 WP_135942522.1 hypothetical protein -
  P8F80_RS00205 (P8F80_00205) - 40511..40765 (+) 255 WP_257588984.1 hypothetical protein -
  P8F80_RS00210 (P8F80_00210) - 40836..42941 (+) 2106 WP_326516404.1 glycoside hydrolase domain-containing protein -
  P8F80_RS00215 (P8F80_00215) - 43039..43656 (-) 618 WP_257577289.1 hypothetical protein -
  P8F80_RS00220 (P8F80_00220) - 43689..44312 (-) 624 WP_135997901.1 hypothetical protein -
  P8F80_RS00225 (P8F80_00225) dnaB 44487..45875 (+) 1389 WP_004049661.1 replicative DNA helicase -

Sequence


Protein


Download         Length: 184 a.a.        Molecular weight: 20064.77 Da        Isoelectric Point: 4.6382

>NTDB_id=810703 P8F80_RS00045 WP_112193831.1 10300..10854(+) (ssb) [Ligilactobacillus murinus strain PC39]
MINSVVLVGRLTRDPELRYTPSGAAVASFTVAIDRRFTNQQGQREADFINCVMWRKAAENFANFTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEVLAENFSLLESKAESERYRAQHGSSNANVQGSAPSNDMQSSNPFGTPANNQTNDAFGGSGFDTTSN
NSNNAADPFAGGQQIDISDDDLPF

Nucleotide


Download         Length: 555 bp        

>NTDB_id=810703 P8F80_RS00045 WP_112193831.1 10300..10854(+) (ssb) [Ligilactobacillus murinus strain PC39]
TTGATCAATTCAGTTGTTCTAGTAGGTCGCTTGACCCGAGATCCTGAACTGCGCTACACGCCTTCAGGGGCAGCCGTGGC
AAGCTTTACTGTCGCGATCGACCGTCGTTTCACTAACCAACAAGGTCAACGTGAAGCTGATTTCATCAATTGTGTAATGT
GGCGTAAAGCAGCCGAAAACTTTGCTAATTTTACCCACAAAGGTTCCTTAGTAGGGATCGAAGGCCGGATCCAAACCCGT
TCTTATGAAAATCAGCAAGGTCAACGTGTTTATGTTACTGAAGTTTTAGCTGAGAATTTCTCACTTTTGGAATCCAAGGC
TGAATCAGAAAGGTATCGTGCCCAACACGGCAGCAGTAACGCTAATGTGCAAGGTTCAGCTCCTTCAAATGATATGCAGT
CATCTAATCCATTTGGGACTCCAGCAAATAATCAGACAAATGATGCTTTTGGTGGTAGTGGTTTTGATACCACTTCAAAC
AATAGTAACAATGCGGCTGATCCATTTGCCGGTGGGCAACAGATCGATATCTCAGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2Z4VY05

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

61.081

100

0.614

  ssbA Bacillus subtilis subsp. subtilis str. 168

56.15

100

0.571