Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   P4829_RS02170 Genome accession   NZ_CP120846
Coordinates   441755..441874 (+) Length   39 a.a.
NCBI ID   WP_063638740.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain MBLB1156     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 436755..446874
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P4829_RS02145 (P4829_02145) - 437813..439159 (+) 1347 WP_063638737.1 MmgE/PrpD family protein -
  P4829_RS02150 (P4829_02150) - 439265..439945 (-) 681 WP_063638738.1 ABC transporter ATP-binding protein -
  P4829_RS02155 (P4829_02155) - 439963..440340 (-) 378 Protein_391 ABC transporter permease -
  P4829_RS02160 (P4829_02160) - 440340..440429 (+) 90 Protein_392 hypothetical protein -
  P4829_RS02165 (P4829_02165) rapC 440623..441771 (+) 1149 WP_004430265.1 tetratricopeptide repeat protein Regulator
  P4829_RS02170 (P4829_02170) phrC 441755..441874 (+) 120 WP_063638740.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  P4829_RS02175 (P4829_02175) - 442009..442116 (-) 108 WP_072053240.1 YjcZ family sporulation protein -
  P4829_RS02180 (P4829_02180) - 442320..442427 (-) 108 WP_035192051.1 YjcZ family sporulation protein -
  P4829_RS02185 (P4829_02185) - 442534..443898 (-) 1365 WP_004430267.1 aspartate kinase -
  P4829_RS02190 (P4829_02190) ceuB 444331..445281 (+) 951 WP_010789705.1 ABC transporter permease Machinery gene
  P4829_RS02195 (P4829_02195) - 445274..446221 (+) 948 WP_063638741.1 iron chelate uptake ABC transporter family permease subunit -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4171.98 Da        Isoelectric Point: 7.9858

>NTDB_id=808817 P4829_RS02170 WP_063638740.1 441755..441874(+) (phrC) [Bacillus atrophaeus strain MBLB1156]
MKLKSKLLIICLAAAAVFATVGVFNAEAPDYQVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=808817 P4829_RS02170 WP_063638740.1 441755..441874(+) (phrC) [Bacillus atrophaeus strain MBLB1156]
ATGAAATTGAAATCTAAATTGCTCATTATTTGTTTGGCTGCAGCTGCTGTGTTTGCAACAGTTGGAGTGTTCAATGCTGA
AGCGCCTGATTATCAGGTGACAGAAAGAGGAATGACGTAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744