Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | P3T49_RS12800 | Genome accession | NZ_CP120723 |
| Coordinates | 2558107..2558280 (+) | Length | 57 a.a. |
| NCBI ID | WP_003325442.1 | Uniprot ID | - |
| Organism | Bacillus atrophaeus strain NX-12 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2553107..2563280
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3T49_RS12785 | gcvT | 2553877..2554971 (-) | 1095 | WP_277713602.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| P3T49_RS12790 | - | 2555432..2557102 (+) | 1671 | WP_277713603.1 | DEAD/DEAH box helicase | - |
| P3T49_RS12795 | - | 2557123..2557917 (+) | 795 | WP_003325443.1 | YqhG family protein | - |
| P3T49_RS12800 | sinI | 2558107..2558280 (+) | 174 | WP_003325442.1 | anti-repressor SinI | Regulator |
| P3T49_RS12805 | sinR | 2558314..2558649 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| P3T49_RS12810 | tasA | 2558840..2559622 (-) | 783 | WP_063638541.1 | biofilm matrix protein TasA | - |
| P3T49_RS12815 | sipW | 2559686..2560258 (-) | 573 | WP_010789195.1 | signal peptidase I SipW | - |
| P3T49_RS12820 | tapA | 2560242..2560943 (-) | 702 | WP_151290438.1 | amyloid fiber anchoring/assembly protein TapA | - |
| P3T49_RS12825 | - | 2561205..2561528 (+) | 324 | WP_088117568.1 | DUF3889 domain-containing protein | - |
| P3T49_RS12830 | - | 2561575..2561754 (-) | 180 | WP_003325435.1 | YqzE family protein | - |
| P3T49_RS12835 | comGG | 2561824..2562198 (-) | 375 | WP_088117569.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| P3T49_RS12840 | comGF | 2562199..2562705 (-) | 507 | WP_274379311.1 | competence type IV pilus minor pilin ComGF | - |
| P3T49_RS12845 | comGE | 2562608..2562955 (-) | 348 | WP_088117570.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6813.90 Da Isoelectric Point: 10.0469
>NTDB_id=808365 P3T49_RS12800 WP_003325442.1 2558107..2558280(+) (sinI) [Bacillus atrophaeus strain NX-12]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF
Nucleotide
Download Length: 174 bp
>NTDB_id=808365 P3T49_RS12800 WP_003325442.1 2558107..2558280(+) (sinI) [Bacillus atrophaeus strain NX-12]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
78.947 |
100 |
0.789 |