Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P3T49_RS12800 Genome accession   NZ_CP120723
Coordinates   2558107..2558280 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain NX-12     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2553107..2563280
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3T49_RS12785 gcvT 2553877..2554971 (-) 1095 WP_277713602.1 glycine cleavage system aminomethyltransferase GcvT -
  P3T49_RS12790 - 2555432..2557102 (+) 1671 WP_277713603.1 DEAD/DEAH box helicase -
  P3T49_RS12795 - 2557123..2557917 (+) 795 WP_003325443.1 YqhG family protein -
  P3T49_RS12800 sinI 2558107..2558280 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  P3T49_RS12805 sinR 2558314..2558649 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P3T49_RS12810 tasA 2558840..2559622 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  P3T49_RS12815 sipW 2559686..2560258 (-) 573 WP_010789195.1 signal peptidase I SipW -
  P3T49_RS12820 tapA 2560242..2560943 (-) 702 WP_151290438.1 amyloid fiber anchoring/assembly protein TapA -
  P3T49_RS12825 - 2561205..2561528 (+) 324 WP_088117568.1 DUF3889 domain-containing protein -
  P3T49_RS12830 - 2561575..2561754 (-) 180 WP_003325435.1 YqzE family protein -
  P3T49_RS12835 comGG 2561824..2562198 (-) 375 WP_088117569.1 competence type IV pilus minor pilin ComGG Machinery gene
  P3T49_RS12840 comGF 2562199..2562705 (-) 507 WP_274379311.1 competence type IV pilus minor pilin ComGF -
  P3T49_RS12845 comGE 2562608..2562955 (-) 348 WP_088117570.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=808365 P3T49_RS12800 WP_003325442.1 2558107..2558280(+) (sinI) [Bacillus atrophaeus strain NX-12]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=808365 P3T49_RS12800 WP_003325442.1 2558107..2558280(+) (sinI) [Bacillus atrophaeus strain NX-12]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789