Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   P5655_RS14365 Genome accession   NZ_CP120681
Coordinates   2621826..2621966 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DSM 10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2616826..2626966
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5655_RS14340 (P5655_14340) yuxO 2617139..2617519 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  P5655_RS14345 (P5655_14345) comA 2617538..2618182 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5655_RS14350 (P5655_14350) comP 2618263..2620572 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  P5655_RS14355 (P5655_14355) comX 2620587..2620754 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  P5655_RS14360 (P5655_14360) comQ 2620742..2621641 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  P5655_RS14365 (P5655_14365) degQ 2621826..2621966 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5655_RS14370 (P5655_14370) - 2622188..2622313 (+) 126 WP_003228793.1 hypothetical protein -
  P5655_RS14375 (P5655_14375) - 2622427..2622795 (+) 369 WP_003243784.1 hypothetical protein -
  P5655_RS14380 (P5655_14380) pdeH 2622771..2624000 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5655_RS14385 (P5655_14385) pncB 2624137..2625609 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5655_RS14390 (P5655_14390) pncA 2625625..2626176 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  P5655_RS14395 (P5655_14395) yueI 2626273..2626671 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=807761 P5655_RS14365 WP_003220708.1 2621826..2621966(-) (degQ) [Bacillus subtilis strain DSM 10]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=807761 P5655_RS14365 WP_003220708.1 2621826..2621966(-) (degQ) [Bacillus subtilis strain DSM 10]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1