Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P5655_RS10490 Genome accession   NZ_CP120681
Coordinates   1917171..1917344 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain DSM 10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1912171..1922344
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5655_RS10475 (P5655_10475) gcvT 1912970..1914058 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  P5655_RS10480 (P5655_10480) hepAA 1914500..1916173 (+) 1674 WP_004398544.1 SNF2-related protein -
  P5655_RS10485 (P5655_10485) yqhG 1916194..1916988 (+) 795 WP_003230200.1 YqhG family protein -
  P5655_RS10490 (P5655_10490) sinI 1917171..1917344 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  P5655_RS10495 (P5655_10495) sinR 1917378..1917713 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5655_RS10500 (P5655_10500) tasA 1917806..1918591 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5655_RS10505 (P5655_10505) sipW 1918655..1919227 (-) 573 WP_003246088.1 signal peptidase I SipW -
  P5655_RS10510 (P5655_10510) tapA 1919211..1919972 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5655_RS10515 (P5655_10515) yqzG 1920244..1920570 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  P5655_RS10520 (P5655_10520) spoIITA 1920612..1920791 (-) 180 WP_003230176.1 YqzE family protein -
  P5655_RS10525 (P5655_10525) comGG 1920862..1921236 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5655_RS10530 (P5655_10530) comGF 1921237..1921620 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5655_RS10535 (P5655_10535) comGE 1921646..1921993 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=807735 P5655_RS10490 WP_003230187.1 1917171..1917344(+) (sinI) [Bacillus subtilis strain DSM 10]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=807735 P5655_RS10490 WP_003230187.1 1917171..1917344(+) (sinI) [Bacillus subtilis strain DSM 10]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1