Detailed information
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | HXS57_RS02205 | Genome accession | NZ_AP023039 |
| Coordinates | 433004..433267 (+) | Length | 87 a.a. |
| NCBI ID | WP_006564000.1 | Uniprot ID | E7G366 |
| Organism | Helicobacter suis strain NHP19-4003 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 432233..473902 | 433004..433267 | within | 0 |
Gene organization within MGE regions
Location: 432233..473902
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HXS57_RS02195 (NHP194003_04450) | - | 432233..432712 (+) | 480 | WP_034375662.1 | hypothetical protein | - |
| HXS57_RS02200 (NHP194003_04460) | comB2 | 432709..432993 (+) | 285 | WP_006563999.1 | TrbC/VirB2 family protein | Machinery gene |
| HXS57_RS02205 (NHP194003_04470) | comB3 | 433004..433267 (+) | 264 | WP_006564000.1 | hypothetical protein | Machinery gene |
| HXS57_RS02210 (NHP194003_04480) | - | 433278..433514 (+) | 237 | WP_034375660.1 | hypothetical protein | - |
| HXS57_RS02215 (NHP194003_04490) | - | 433514..436087 (+) | 2574 | WP_176485818.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| HXS57_RS02220 (NHP194003_04500) | - | 436199..437461 (-) | 1263 | WP_176485819.1 | RNA-guided endonuclease InsQ/TnpB family protein | - |
| HXS57_RS02225 (NHP194003_04510) | tnpA | 437496..437912 (+) | 417 | WP_034376938.1 | IS200/IS605 family transposase | - |
| HXS57_RS02230 (NHP194003_04520) | - | 438037..438561 (+) | 525 | Protein_456 | hypothetical protein | - |
| HXS57_RS02235 (NHP194003_04530) | tnpA | 438614..439042 (-) | 429 | WP_034376438.1 | IS200/IS605 family transposase | - |
| HXS57_RS02240 (NHP194003_04540) | - | 439107..440372 (+) | 1266 | WP_073117560.1 | RNA-guided endonuclease InsQ/TnpB family protein | - |
| HXS57_RS02245 (NHP194003_04550) | - | 440377..441021 (+) | 645 | Protein_459 | type IV secretion system protein | - |
| HXS57_RS02250 (NHP194003_04560) | - | 441018..442685 (+) | 1668 | WP_176485820.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HXS57_RS02255 (NHP194003_04570) | comB10 | 442682..443884 (+) | 1203 | WP_176485821.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| HXS57_RS02260 (NHP194003_04580) | - | 443868..446117 (+) | 2250 | WP_176485822.1 | collagen-like protein | - |
| HXS57_RS02265 (NHP194003_04590) | - | 446130..447107 (+) | 978 | WP_176485823.1 | hypothetical protein | - |
| HXS57_RS02270 (NHP194003_04600) | - | 447125..447379 (+) | 255 | WP_176485824.1 | hypothetical protein | - |
| HXS57_RS02275 (NHP194003_04610) | - | 447384..448328 (+) | 945 | WP_006564526.1 | CpaF/VirB11 family protein | - |
| HXS57_RS02280 (NHP194003_04620) | - | 448325..448843 (+) | 519 | WP_033588775.1 | hypothetical protein | - |
| HXS57_RS02285 (NHP194003_04630) | - | 448840..451104 (+) | 2265 | WP_034375654.1 | type IV secretory system conjugative DNA transfer family protein | - |
| HXS57_RS02290 (NHP194003_04640) | - | 451124..451597 (+) | 474 | Protein_468 | hypothetical protein | - |
| HXS57_RS08970 (NHP194003_04650) | - | 451761..452081 (+) | 321 | WP_006564537.1 | hypothetical protein | - |
| HXS57_RS02300 (NHP194003_04660) | - | 452094..454154 (+) | 2061 | WP_034375651.1 | type IA DNA topoisomerase | - |
| HXS57_RS02305 (NHP194003_04670) | - | 454209..454679 (+) | 471 | WP_000965788.1 | hypothetical protein | - |
| HXS57_RS02310 (NHP194003_04680) | - | 454649..454804 (+) | 156 | WP_158650290.1 | hypothetical protein | - |
| HXS57_RS02315 (NHP194003_04690) | - | 454786..455391 (-) | 606 | WP_104705861.1 | hypothetical protein | - |
| HXS57_RS02320 (NHP194003_04700) | - | 455369..455737 (-) | 369 | WP_021305613.1 | hypothetical protein | - |
| HXS57_RS08975 | - | 455784..456451 (-) | 668 | Protein_475 | AAA family ATPase | - |
| HXS57_RS02335 (NHP194003_04730) | - | 457089..457253 (+) | 165 | WP_006564534.1 | hypothetical protein | - |
| HXS57_RS02340 (NHP194003_04740) | - | 457254..458306 (+) | 1053 | WP_040499211.1 | ArdC family protein | - |
| HXS57_RS02345 (NHP194003_04750) | - | 458306..460162 (+) | 1857 | WP_176485348.1 | hypothetical protein | - |
| HXS57_RS02350 (NHP194003_04760) | - | 460172..461605 (+) | 1434 | WP_104707234.1 | hypothetical protein | - |
| HXS57_RS02355 (NHP194003_04770) | - | 461602..462852 (+) | 1251 | WP_006564531.1 | P-type conjugative transfer protein TrbL | - |
| HXS57_RS02360 (NHP194003_04780) | - | 462864..464105 (+) | 1242 | WP_176485825.1 | hypothetical protein | - |
| HXS57_RS02365 (NHP194003_04790) | - | 464109..464756 (-) | 648 | WP_104707240.1 | hypothetical protein | - |
| HXS57_RS02370 (NHP194003_04800) | - | 465006..465486 (+) | 481 | Protein_483 | hypothetical protein | - |
| HXS57_RS02375 (NHP194003_04810) | - | 465618..465869 (+) | 252 | WP_000006537.1 | hypothetical protein | - |
| HXS57_RS02380 (NHP194003_04820) | - | 465841..466644 (+) | 804 | WP_034375708.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| HXS57_RS02385 (NHP194003_04830) | - | 466962..468029 (-) | 1068 | WP_176485826.1 | tyrosine-type recombinase/integrase | - |
| HXS57_RS02390 (NHP194003_04840) | - | 469126..471111 (-) | 1986 | WP_176485362.1 | relaxase/mobilization nuclease domain-containing protein | - |
| HXS57_RS02395 (NHP194003_04850) | - | 472264..472431 (+) | 168 | Protein_488 | ATP phosphoribosyltransferase regulatory subunit | - |
| HXS57_RS02400 (NHP194003_04860) | - | 472396..472878 (-) | 483 | WP_309298907.1 | nitrate- and nitrite sensing domain-containing protein | - |
| HXS57_RS02405 (NHP194003_04870) | - | 473198..473902 (+) | 705 | WP_176485827.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9974.84 Da Isoelectric Point: 5.7206
>NTDB_id=80771 HXS57_RS02205 WP_006564000.1 433004..433267(+) (comB3) [Helicobacter suis strain NHP19-4003]
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFVPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KSNSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFVPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KSNSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=80771 HXS57_RS02205 WP_006564000.1 433004..433267(+) (comB3) [Helicobacter suis strain NHP19-4003]
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGCTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAAAG
CTTTTTAATCGCAGGATTTGTTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAGATTAAAACC
AAATCCAATTCATTTTATGCTTAA
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGCTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAAAG
CTTTTTAATCGCAGGATTTGTTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAGATTAAAACC
AAATCCAATTCATTTTATGCTTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
58.621 |
100 |
0.586 |