Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P3X63_RS13545 Genome accession   NZ_CP120679
Coordinates   2626620..2626796 (+) Length   58 a.a.
NCBI ID   WP_026587842.1    Uniprot ID   A0A6I7FAJ8
Organism   Bacillus sp. HSf4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2621620..2631796
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3X63_RS13530 (P3X63_13530) gcvT 2622279..2623373 (-) 1095 WP_026587839.1 glycine cleavage system aminomethyltransferase GcvT -
  P3X63_RS13535 (P3X63_13535) - 2623957..2625636 (+) 1680 WP_026587840.1 SNF2-related protein -
  P3X63_RS13540 (P3X63_13540) - 2625640..2626434 (+) 795 WP_026587841.1 YqhG family protein -
  P3X63_RS13545 (P3X63_13545) sinI 2626620..2626796 (+) 177 WP_026587842.1 anti-repressor SinI family protein Regulator
  P3X63_RS13550 (P3X63_13550) sinR 2626830..2627165 (+) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  P3X63_RS13555 (P3X63_13555) - 2627275..2628069 (-) 795 WP_277691017.1 TasA family protein -
  P3X63_RS13560 (P3X63_13560) - 2628138..2628722 (-) 585 WP_026587844.1 signal peptidase I -
  P3X63_RS13565 (P3X63_13565) tapA 2628719..2629447 (-) 729 WP_026587845.1 amyloid fiber anchoring/assembly protein TapA -
  P3X63_RS13570 (P3X63_13570) - 2629717..2630034 (+) 318 WP_026587846.1 YqzG/YhdC family protein -
  P3X63_RS13575 (P3X63_13575) - 2630326..2630511 (-) 186 WP_277691018.1 YqzE family protein -
  P3X63_RS13580 (P3X63_13580) comGG 2630583..2630948 (-) 366 WP_026587848.1 competence type IV pilus minor pilin ComGG -
  P3X63_RS13585 (P3X63_13585) comGF 2630962..2631450 (-) 489 WP_277691019.1 competence type IV pilus minor pilin ComGF -
  P3X63_RS13590 (P3X63_13590) comGE 2631359..2631706 (-) 348 WP_277691020.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6765.57 Da        Isoelectric Point: 5.1069

>NTDB_id=807667 P3X63_RS13545 WP_026587842.1 2626620..2626796(+) (sinI) [Bacillus sp. HSf4]
MNKDKNEKEEWDEEWAELIKNALKAGISPEEIRFFLRLGKKSSEASTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=807667 P3X63_RS13545 WP_026587842.1 2626620..2626796(+) (sinI) [Bacillus sp. HSf4]
ATGAATAAAGATAAAAATGAGAAAGAAGAATGGGATGAGGAATGGGCAGAGCTGATCAAAAATGCCCTGAAAGCAGGCAT
TAGTCCAGAAGAAATACGGTTTTTTCTTCGTTTAGGAAAGAAGTCTTCCGAAGCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(12-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I7FAJ8

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5