Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   P5661_RS13060 Genome accession   NZ_CP120600
Coordinates   2473597..2473980 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain PRO112     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2468597..2478980
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5661_RS13020 (P5661_13020) sinI 2469531..2469704 (+) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  P5661_RS13025 (P5661_13025) sinR 2469738..2470073 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5661_RS13030 (P5661_13030) tasA 2470165..2470950 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  P5661_RS13035 (P5661_13035) sipW 2471015..2471587 (-) 573 WP_086344613.1 signal peptidase I -
  P5661_RS13040 (P5661_13040) tapA 2471571..2472332 (-) 762 WP_277708795.1 amyloid fiber anchoring/assembly protein TapA -
  P5661_RS13045 (P5661_13045) yqzG 2472603..2472929 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  P5661_RS13050 (P5661_13050) spoIIT 2472971..2473150 (-) 180 WP_014480252.1 YqzE family protein -
  P5661_RS13055 (P5661_13055) comGG 2473222..2473596 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  P5661_RS13060 (P5661_13060) comGF 2473597..2473980 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  P5661_RS13065 (P5661_13065) comGE 2474006..2474353 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  P5661_RS13070 (P5661_13070) comGD 2474337..2474768 (-) 432 WP_163136251.1 comG operon protein ComGD Machinery gene
  P5661_RS13075 (P5661_13075) comGC 2474758..2475054 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  P5661_RS13080 (P5661_13080) comGB 2475068..2476105 (-) 1038 WP_163136249.1 comG operon protein ComGB Machinery gene
  P5661_RS13085 (P5661_13085) comGA 2476092..2477162 (-) 1071 WP_032726161.1 competence protein ComGA Machinery gene
  P5661_RS13090 (P5661_13090) - 2477374..2477571 (-) 198 WP_032726162.1 hypothetical protein -
  P5661_RS13095 (P5661_13095) corA 2477573..2478526 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=806579 P5661_RS13060 WP_032726158.1 2473597..2473980(-) (comGF) [Bacillus subtilis strain PRO112]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=806579 P5661_RS13060 WP_032726158.1 2473597..2473980(-) (comGF) [Bacillus subtilis strain PRO112]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGATATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992