Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P5661_RS13020 Genome accession   NZ_CP120600
Coordinates   2469531..2469704 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PRO112     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2464531..2474704
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5661_RS13005 (P5661_13005) gcvT 2465329..2466417 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  P5661_RS13010 (P5661_13010) yqhH 2466859..2468532 (+) 1674 WP_038829735.1 SNF2-related protein -
  P5661_RS13015 (P5661_13015) yqhG 2468553..2469347 (+) 795 WP_021480015.1 YqhG family protein -
  P5661_RS13020 (P5661_13020) sinI 2469531..2469704 (+) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  P5661_RS13025 (P5661_13025) sinR 2469738..2470073 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5661_RS13030 (P5661_13030) tasA 2470165..2470950 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  P5661_RS13035 (P5661_13035) sipW 2471015..2471587 (-) 573 WP_086344613.1 signal peptidase I -
  P5661_RS13040 (P5661_13040) tapA 2471571..2472332 (-) 762 WP_277708795.1 amyloid fiber anchoring/assembly protein TapA -
  P5661_RS13045 (P5661_13045) yqzG 2472603..2472929 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  P5661_RS13050 (P5661_13050) spoIIT 2472971..2473150 (-) 180 WP_014480252.1 YqzE family protein -
  P5661_RS13055 (P5661_13055) comGG 2473222..2473596 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  P5661_RS13060 (P5661_13060) comGF 2473597..2473980 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  P5661_RS13065 (P5661_13065) comGE 2474006..2474353 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=806576 P5661_RS13020 WP_014477323.1 2469531..2469704(+) (sinI) [Bacillus subtilis strain PRO112]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=806576 P5661_RS13020 WP_014477323.1 2469531..2469704(+) (sinI) [Bacillus subtilis strain PRO112]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982