Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   P5622_RS08185 Genome accession   NZ_CP120598
Coordinates   1579346..1579513 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain PRO115     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 1574346..1584513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5622_RS08155 (P5622_08155) pncB 1574491..1575963 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5622_RS08160 (P5622_08160) pdeH 1576100..1577329 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5622_RS08165 (P5622_08165) - 1577305..1577673 (-) 369 WP_003243784.1 hypothetical protein -
  P5622_RS08170 (P5622_08170) - 1577787..1577912 (-) 126 WP_003228793.1 hypothetical protein -
  P5622_RS08175 (P5622_08175) degQ 1578134..1578274 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5622_RS08180 (P5622_08180) comQ 1578459..1579358 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  P5622_RS08185 (P5622_08185) comX 1579346..1579513 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  P5622_RS08190 (P5622_08190) comP 1579528..1581836 (+) 2309 Protein_1572 two-component system sensor histidine kinase ComP -
  P5622_RS08195 (P5622_08195) comA 1581918..1582562 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5622_RS08200 (P5622_08200) yuxO 1582581..1582961 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  P5622_RS08205 (P5622_08205) mnhG 1583000..1583374 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  P5622_RS08210 (P5622_08210) mrpF 1583358..1583642 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  P5622_RS08215 (P5622_08215) mrpE 1583642..1584118 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=806428 P5622_RS08185 WP_003242801.1 1579346..1579513(+) (comX) [Bacillus subtilis strain PRO115]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=806428 P5622_RS08185 WP_003242801.1 1579346..1579513(+) (comX) [Bacillus subtilis strain PRO115]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1