Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   P5628_RS12355 Genome accession   NZ_CP120577
Coordinates   2384373..2384756 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain PRO53     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2379373..2389756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5628_RS12315 (P5628_12315) sinI 2380307..2380480 (+) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  P5628_RS12320 (P5628_12320) sinR 2380514..2380849 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5628_RS12325 (P5628_12325) tasA 2380941..2381726 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  P5628_RS12330 (P5628_12330) sipW 2381791..2382363 (-) 573 WP_086344613.1 signal peptidase I -
  P5628_RS12335 (P5628_12335) tapA 2382347..2383108 (-) 762 WP_277708795.1 amyloid fiber anchoring/assembly protein TapA -
  P5628_RS12340 (P5628_12340) yqzG 2383379..2383705 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  P5628_RS12345 (P5628_12345) spoIIT 2383747..2383926 (-) 180 WP_014480252.1 YqzE family protein -
  P5628_RS12350 (P5628_12350) comGG 2383998..2384372 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  P5628_RS12355 (P5628_12355) comGF 2384373..2384756 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  P5628_RS12360 (P5628_12360) comGE 2384782..2385129 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  P5628_RS12365 (P5628_12365) comGD 2385113..2385544 (-) 432 WP_163136251.1 comG operon protein ComGD Machinery gene
  P5628_RS12370 (P5628_12370) comGC 2385534..2385830 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  P5628_RS12375 (P5628_12375) comGB 2385844..2386881 (-) 1038 WP_163136249.1 comG operon protein ComGB Machinery gene
  P5628_RS12380 (P5628_12380) comGA 2386868..2387938 (-) 1071 WP_032726161.1 competence protein ComGA Machinery gene
  P5628_RS12385 (P5628_12385) - 2388150..2388347 (-) 198 WP_032726162.1 hypothetical protein -
  P5628_RS12390 (P5628_12390) corA 2388349..2389303 (-) 955 Protein_2395 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=806308 P5628_RS12355 WP_032726158.1 2384373..2384756(-) (comGF) [Bacillus subtilis strain PRO53]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=806308 P5628_RS12355 WP_032726158.1 2384373..2384756(-) (comGF) [Bacillus subtilis strain PRO53]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGATATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992