Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | P3L57_RS15735 | Genome accession | NZ_CP120511 |
| Coordinates | 3148190..3148330 (-) | Length | 46 a.a. |
| NCBI ID | WP_024122683.1 | Uniprot ID | A0A9Q4HP57 |
| Organism | Bacillus sp. B28 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3143190..3153330
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3L57_RS15710 (P3L57_15710) | - | 3143514..3143894 (-) | 381 | WP_069486982.1 | hotdog fold thioesterase | - |
| P3L57_RS15715 (P3L57_15715) | comA | 3143912..3144556 (-) | 645 | WP_024122680.1 | two-component system response regulator ComA | Regulator |
| P3L57_RS15720 (P3L57_15720) | comP | 3144637..3146955 (-) | 2319 | WP_069486981.1 | sensor histidine kinase | Regulator |
| P3L57_RS15725 (P3L57_15725) | comX | 3146975..3147151 (-) | 177 | WP_041906074.1 | competence pheromone ComX | - |
| P3L57_RS15730 (P3L57_15730) | - | 3147166..3148059 (-) | 894 | WP_306481639.1 | polyprenyl synthetase family protein | - |
| P3L57_RS15735 (P3L57_15735) | degQ | 3148190..3148330 (-) | 141 | WP_024122683.1 | degradation enzyme regulation protein DegQ | Regulator |
| P3L57_RS15740 (P3L57_15740) | - | 3148791..3149159 (+) | 369 | WP_044158947.1 | hypothetical protein | - |
| P3L57_RS15745 (P3L57_15745) | - | 3149135..3150364 (-) | 1230 | WP_059334756.1 | EAL and HDOD domain-containing protein | - |
| P3L57_RS15750 (P3L57_15750) | - | 3150500..3151969 (-) | 1470 | WP_024122686.1 | nicotinate phosphoribosyltransferase | - |
| P3L57_RS15755 (P3L57_15755) | - | 3151985..3152536 (-) | 552 | WP_044158950.1 | isochorismatase family cysteine hydrolase | - |
| P3L57_RS15760 (P3L57_15760) | - | 3152632..3153030 (-) | 399 | WP_059334761.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5533.44 Da Isoelectric Point: 6.2559
>NTDB_id=805951 P3L57_RS15735 WP_024122683.1 3148190..3148330(-) (degQ) [Bacillus sp. B28]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=805951 P3L57_RS15735 WP_024122683.1 3148190..3148330(-) (degQ) [Bacillus sp. B28]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
97.826 |
100 |
0.978 |