Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   P3L57_RS12365 Genome accession   NZ_CP120511
Coordinates   2508512..2508895 (-) Length   127 a.a.
NCBI ID   WP_175422400.1    Uniprot ID   -
Organism   Bacillus sp. B28     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2503512..2513895
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3L57_RS12325 (P3L57_12325) sinI 2504448..2504621 (+) 174 WP_024122036.1 anti-repressor SinI family protein Regulator
  P3L57_RS12330 (P3L57_12330) sinR 2504655..2504990 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P3L57_RS12335 (P3L57_12335) tasA 2505076..2505861 (-) 786 WP_059293609.1 biofilm matrix protein TasA -
  P3L57_RS12340 (P3L57_12340) - 2505926..2506510 (-) 585 WP_059293608.1 signal peptidase I -
  P3L57_RS12345 (P3L57_12345) tapA 2506482..2507243 (-) 762 WP_069487187.1 amyloid fiber anchoring/assembly protein TapA -
  P3L57_RS12350 (P3L57_12350) - 2507520..2507843 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  P3L57_RS12355 (P3L57_12355) - 2507886..2508065 (-) 180 WP_003236949.1 YqzE family protein -
  P3L57_RS12360 (P3L57_12360) comGG 2508137..2508511 (-) 375 WP_059335411.1 competence type IV pilus minor pilin ComGG Machinery gene
  P3L57_RS12365 (P3L57_12365) comGF 2508512..2508895 (-) 384 WP_175422400.1 competence type IV pilus minor pilin ComGF Machinery gene
  P3L57_RS12370 (P3L57_12370) comGE 2508921..2509268 (-) 348 WP_069487185.1 competence type IV pilus minor pilin ComGE Machinery gene
  P3L57_RS12375 (P3L57_12375) comGD 2509252..2509683 (-) 432 WP_044154579.1 competence type IV pilus minor pilin ComGD Machinery gene
  P3L57_RS12380 (P3L57_12380) comGC 2509673..2509969 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  P3L57_RS12385 (P3L57_12385) comGB 2509983..2511020 (-) 1038 WP_059293603.1 competence type IV pilus assembly protein ComGB Machinery gene
  P3L57_RS12390 (P3L57_12390) comGA 2511007..2512077 (-) 1071 WP_059293602.1 competence protein ComGA Machinery gene
  P3L57_RS12395 (P3L57_12395) - 2512399..2512809 (-) 411 WP_059293601.1 CBS domain-containing protein -
  P3L57_RS12400 (P3L57_12400) corA 2512872..2513825 (-) 954 WP_044154576.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14734.00 Da        Isoelectric Point: 7.3829

>NTDB_id=805930 P3L57_RS12365 WP_175422400.1 2508512..2508895(-) (comGF) [Bacillus sp. B28]
MLISGSLAMYFHLFLLRQQENEGFMQREWIISVEQIMNECKQSQTVQTDEHGSVLICRNLSGQEVRFEIYHSMIRKRVDG
KGHVPILDHIKTMKAEVKNGMLWLKVKNENDKEYQTAFPVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=805930 P3L57_RS12365 WP_175422400.1 2508512..2508895(-) (comGF) [Bacillus sp. B28]
TTGCTCATATCAGGATCGTTAGCGATGTACTTTCATCTATTTTTGTTACGTCAACAGGAGAATGAGGGCTTCATGCAGCG
GGAATGGATCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGCAATCGCAGACAGTGCAGACAGATGAGCATGGGAGCG
TCTTAATCTGCAGAAATCTGTCAGGGCAAGAGGTCCGTTTTGAAATCTACCATTCAATGATCAGGAAAAGAGTAGACGGA
AAAGGGCATGTTCCGATTCTTGACCATATTAAAACAATGAAAGCCGAGGTTAAAAACGGGATGCTTTGGCTGAAAGTCAA
GAATGAGAATGATAAAGAGTATCAAACAGCTTTTCCGGTATATACGTCGTTAGGAGGTGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(17-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

72.441

100

0.724