Detailed information NTG0799840

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P1289_RS13125
• Genome accession: NZ_CP119589
• Coordinates: 2769027..2769344 (+)
• Length: 105 a.a.
• NCBI ID: WP_225523057.1
• Uniprot ID: -
• Organism: Staphylococcus xylosus strain H-1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2764027..2774344

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P1289_RS13090 (P1289_13065)	-	2764377..2764571 (+)	195	WP_042363548.1	YqgQ family protein	-
P1289_RS13095 (P1289_13070)	-	2764961..2765947 (+)	987	WP_029377187.1	glucokinase	-
P1289_RS13100 (P1289_13075)	-	2765947..2766270 (+)	324	WP_042362616.1	MTH1187 family thiamine-binding protein	-
P1289_RS13105 (P1289_13080)	-	2766272..2766895 (+)	624	WP_042362617.1	MBL fold metallo-hydrolase	-
P1289_RS13110 (P1289_13085)	comGA	2766994..2767968 (+)	975	WP_069794318.1	competence type IV pilus ATPase ComGA	Machinery gene
P1289_RS13115	-	2767940..2768287 (+)	348	WP_318651801.1	hypothetical protein	-
P1289_RS13120 (P1289_13090)	comGB	2768300..2769007 (+)	708	Protein_2535	competence type IV pilus assembly protein ComGB	-
P1289_RS13125 (P1289_13095)	comGC	2769027..2769344 (+)	318	WP_225523057.1	competence type IV pilus major pilin ComGC	Machinery gene
P1289_RS13130 (P1289_13100)	comGD	2769322..2769768 (+)	447	WP_225526499.1	competence type IV pilus minor pilin ComGD	-
P1289_RS13135 (P1289_13105)	-	2769755..2770054 (+)	300	WP_069794320.1	hypothetical protein	-
P1289_RS13140 (P1289_13110)	comGF	2770026..2770469 (+)	444	WP_069794321.1	competence type IV pilus minor pilin ComGF	-
P1289_RS13145 (P1289_13115)	-	2770628..2771149 (+)	522	WP_047172318.1	shikimate kinase	-
P1289_RS13150 (P1289_13120)	gcvT	2771337..2772428 (+)	1092	WP_042362624.1	glycine cleavage system aminomethyltransferase GcvT	-
P1289_RS13155 (P1289_13125)	gcvPA	2772446..2773798 (+)	1353	WP_042362625.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11789.84 Da
• Isoelectric Point: 7.8219

>NTDB_id=799840 P1289_RS13125 WP_225523057.1 2769027..2769344(+) (comGC) [Staphylococcus xylosus strain H-1]
MDNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=799840 P1289_RS13125 WP_225523057.1 2769027..2769344(+) (comGC) [Staphylococcus xylosus strain H-1]
ATGGATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGTAAGTCAGGTGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	70.297	96.19	0.676
comGC	Staphylococcus aureus MW2	70.297	96.19	0.676
comYC	Streptococcus gordonii str. Challis substr. CH1	46.078	97.143	0.448
comGC/cglC	Streptococcus pneumoniae D39	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae R6	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	39.623	100	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	40	100	0.4
comGC/cglC	Streptococcus mitis SK321	41.667	91.429	0.381
comGC	Bacillus subtilis subsp. subtilis str. 168	41.489	89.524	0.371
comYC	Streptococcus mutans UA140	49.351	73.333	0.362
comYC	Streptococcus mutans UA159	49.351	73.333	0.362