Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   PYW31_RS08200 Genome accession   NZ_CP118976
Coordinates   1684608..1685477 (-) Length   289 a.a.
NCBI ID   WP_046836242.1    Uniprot ID   A0A1S2MKE5
Organism   Staphylococcus succinus strain DSM 14617     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1642153..1704384 1684608..1685477 within 0


Gene organization within MGE regions


Location: 1642153..1704384
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYW31_RS08040 yfmH 1642730..1644016 (-) 1287 WP_046836274.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  PYW31_RS08045 yfmF 1644013..1645305 (-) 1293 WP_046836273.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  PYW31_RS08050 - 1645316..1646029 (-) 714 WP_046836272.1 GntR family transcriptional regulator -
  PYW31_RS13735 - 1646032..1647483 (-) 1452 Protein_1552 DNA translocase FtsK -
  PYW31_RS13740 - 1647654..1648482 (-) 829 Protein_1553 cell division protein FtsK -
  PYW31_RS08060 rnjB 1648793..1650466 (-) 1674 WP_046836270.1 ribonuclease J2 -
  PYW31_RS08065 pnp 1650852..1652951 (-) 2100 WP_046836269.1 polyribonucleotide nucleotidyltransferase -
  PYW31_RS08070 rpsO 1653104..1653373 (-) 270 WP_046836268.1 30S ribosomal protein S15 -
  PYW31_RS08075 - 1653477..1654448 (-) 972 WP_046836267.1 bifunctional riboflavin kinase/FAD synthetase -
  PYW31_RS08080 truB 1654462..1655379 (-) 918 WP_046836266.1 tRNA pseudouridine(55) synthase TruB -
  PYW31_RS08085 rbfA 1655511..1655855 (-) 345 WP_046836265.1 30S ribosome-binding factor RbfA -
  PYW31_RS08090 - 1656296..1657168 (+) 873 WP_046836264.1 HTH domain-containing protein -
  PYW31_RS08095 - 1657264..1658256 (-) 993 WP_235602239.1 hypothetical protein -
  PYW31_RS08100 infB 1659176..1661299 (-) 2124 WP_046836262.1 translation initiation factor IF-2 -
  PYW31_RS08105 - 1661304..1661621 (-) 318 WP_046836261.1 L7Ae/L30e/S12e/Gadd45 family ribosomal protein -
  PYW31_RS08110 rnpM 1661618..1661902 (-) 285 WP_046836260.1 RNase P modulator RnpM -
  PYW31_RS08115 nusA 1661920..1663113 (-) 1194 WP_046836259.1 transcription termination factor NusA -
  PYW31_RS08120 rimP 1663134..1663601 (-) 468 WP_046836258.1 ribosome maturation factor RimP -
  PYW31_RS08125 - 1663835..1668151 (-) 4317 WP_046836257.1 PolC-type DNA polymerase III -
  PYW31_RS08130 - 1668424..1670124 (-) 1701 WP_046836256.1 proline--tRNA ligase -
  PYW31_RS08135 rseP 1670145..1671431 (-) 1287 WP_046836255.1 RIP metalloprotease RseP -
  PYW31_RS08140 - 1671749..1672531 (-) 783 WP_046836254.1 phosphatidate cytidylyltransferase -
  PYW31_RS08145 - 1672549..1673313 (-) 765 WP_046836253.1 isoprenyl transferase -
  PYW31_RS08150 frr 1673547..1674101 (-) 555 WP_046836252.1 ribosome recycling factor -
  PYW31_RS08155 pyrH 1674118..1674840 (-) 723 WP_046836251.1 UMP kinase -
  PYW31_RS08160 tsf 1674974..1675852 (-) 879 WP_046836250.1 translation elongation factor Ts -
  PYW31_RS08165 rpsB 1675947..1676735 (-) 789 WP_046836249.1 30S ribosomal protein S2 -
  PYW31_RS08170 codY 1676988..1677761 (-) 774 WP_046836248.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  PYW31_RS08175 hslU 1677786..1679195 (-) 1410 WP_046836247.1 ATP-dependent protease ATPase subunit HslU -
  PYW31_RS08180 hslV 1679325..1679867 (-) 543 WP_046836246.1 ATP-dependent protease subunit HslV -
  PYW31_RS08185 xerC 1679871..1680761 (-) 891 WP_046836245.1 tyrosine recombinase XerC -
  PYW31_RS08190 trmFO 1680880..1682187 (-) 1308 WP_046836244.1 methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO -
  PYW31_RS08195 topA 1682346..1684412 (-) 2067 WP_046836243.1 type I DNA topoisomerase -
  PYW31_RS08200 dprA 1684608..1685477 (-) 870 WP_046836242.1 DNA-processing protein DprA Machinery gene
  PYW31_RS08205 sucD 1685828..1686736 (-) 909 WP_046836241.1 succinate--CoA ligase subunit alpha -
  PYW31_RS08210 sucC 1686758..1687924 (-) 1167 WP_046836240.1 ADP-forming succinate--CoA ligase subunit beta -
  PYW31_RS08215 - 1688032..1688802 (-) 771 WP_046836239.1 ribonuclease HII -
  PYW31_RS08220 ylqF 1688810..1689670 (-) 861 WP_046836238.1 ribosome biogenesis GTPase YlqF -
  PYW31_RS08225 - 1690073..1692652 (+) 2580 WP_046836237.1 YfhO family protein -
  PYW31_RS08230 - 1692704..1695313 (+) 2610 WP_046836236.1 YfhO family protein -
  PYW31_RS08235 rplS 1695505..1695855 (-) 351 WP_046836235.1 50S ribosomal protein L19 -
  PYW31_RS08240 trmD 1695957..1696694 (-) 738 WP_046836234.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PYW31_RS08245 rimM 1696694..1697200 (-) 507 WP_046836233.1 ribosome maturation factor RimM -
  PYW31_RS08250 rpsP 1697470..1697736 (-) 267 WP_046836232.1 30S ribosomal protein S16 -
  PYW31_RS08255 - 1698364..1699116 (+) 753 WP_046836231.1 3-oxoacyl-ACP reductase -
  PYW31_RS08260 - 1699150..1700451 (+) 1302 WP_371261097.1 LLM class flavin-dependent oxidoreductase -
  PYW31_RS08265 ffh 1700551..1701918 (-) 1368 WP_046836229.1 signal recognition particle protein -
  PYW31_RS08270 - 1701944..1702276 (-) 333 WP_046836228.1 putative DNA-binding protein -
  PYW31_RS08275 ftsY 1702263..1703480 (-) 1218 WP_046836227.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 289 a.a.        Molecular weight: 33559.81 Da        Isoelectric Point: 9.5824

>NTDB_id=797086 PYW31_RS08200 WP_046836242.1 1684608..1685477(-) (dprA) [Staphylococcus succinus strain DSM 14617]
MKEYQYLKLRFSGLTTQQIRQLLKGYPYFLECNEIEQHYLLKQFLSILNVRRKTHIYNKFLNYNVEQILLQMQQWHVNYI
PITHPHYPQLLREIYDPPYILFYKGNISILQLPNTLAVIGSRNATQYTDKALSYLFPSFKKVNMTIVSGLAKGADYKAHR
YALSMDMPSIAVLGFGHLYHYPKETQGIRNQLEVEGLVISEYLPNQTPQKYYFPERNRLISGLSKGILITESKSVSGTRI
TTHCALEQNREVYVLPGSMFNELTKGNLLSAQEGAKIVLRPSDIINDFH

Nucleotide


Download         Length: 870 bp        

>NTDB_id=797086 PYW31_RS08200 WP_046836242.1 1684608..1685477(-) (dprA) [Staphylococcus succinus strain DSM 14617]
ATGAAAGAATACCAATATTTAAAACTACGTTTTTCTGGATTGACTACACAGCAAATAAGACAACTTTTAAAAGGTTATCC
TTATTTCTTAGAGTGTAATGAAATTGAACAACATTATTTACTCAAACAGTTTTTATCTATTTTGAATGTTAGACGTAAAA
CGCATATATATAATAAATTTTTAAATTACAATGTTGAACAAATTTTATTACAAATGCAACAGTGGCATGTCAATTATATA
CCGATTACACATCCCCATTACCCTCAATTACTACGGGAAATTTACGACCCTCCATATATTCTTTTCTACAAAGGAAACAT
ATCTATATTACAATTGCCAAACACATTGGCAGTCATTGGTTCAAGAAATGCTACTCAATATACAGACAAAGCATTAAGCT
ATCTTTTTCCTTCATTTAAAAAAGTAAACATGACAATTGTTTCAGGTTTAGCTAAAGGTGCCGACTATAAAGCGCACCGA
TATGCGCTAAGTATGGATATGCCTTCTATTGCTGTGCTAGGTTTTGGACATTTATATCATTATCCTAAAGAAACACAAGG
AATCAGAAATCAACTTGAAGTTGAGGGGCTAGTGATAAGCGAATACTTACCAAATCAAACGCCACAAAAATATTATTTTC
CCGAACGAAATAGATTAATTAGTGGATTATCCAAAGGTATATTAATTACAGAATCTAAGTCAGTAAGTGGCACACGTATT
ACGACTCATTGCGCCTTGGAACAAAATAGAGAAGTATATGTTTTGCCAGGATCCATGTTTAATGAATTGACAAAGGGTAA
TTTATTGAGTGCACAAGAAGGTGCAAAAATCGTTTTGAGACCAAGTGATATTATAAATGACTTTCATTAA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1S2MKE5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

49.477

99.308

0.491
  dprA Staphylococcus aureus N315

48.78

99.308

0.484