Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   PYW39_RS07480 Genome accession   NZ_CP118973
Coordinates   1544758..1545633 (-) Length   291 a.a.
NCBI ID   WP_373364739.1    Uniprot ID   -
Organism   Staphylococcus warneri strain DSM 20316     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1498307..1572256 1544758..1545633 within 0


Gene organization within MGE regions


Location: 1498307..1572256
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYW39_RS07290 - 1498788..1499003 (+) 216 WP_002467042.1 hypothetical protein -
  PYW39_RS07295 rny 1499125..1500684 (-) 1560 WP_015365062.1 ribonuclease Y -
  PYW39_RS07300 recA 1501131..1502177 (-) 1047 WP_002451246.1 recombinase RecA Machinery gene
  PYW39_RS07305 - 1502344..1503495 (-) 1152 WP_002465812.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  PYW39_RS07310 pgsA 1503668..1504243 (-) 576 WP_103286311.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  PYW39_RS07315 - 1504274..1504666 (-) 393 WP_002465806.1 helix-turn-helix domain-containing protein -
  PYW39_RS07320 - 1504687..1505523 (-) 837 WP_015365064.1 YmfK family protein -
  PYW39_RS07325 ymfI 1505658..1506362 (-) 705 WP_002465810.1 elongation factor P 5-aminopentanone reductase -
  PYW39_RS07330 yfmH 1506359..1507648 (-) 1290 WP_015365066.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  PYW39_RS07335 yfmF 1507648..1508934 (-) 1287 WP_037539758.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  PYW39_RS07340 - 1508947..1509660 (-) 714 WP_049414672.1 GntR family transcriptional regulator -
  PYW39_RS11965 - 1509663..1511114 (-) 1452 Protein_1407 DNA translocase FtsK -
  PYW39_RS11970 - 1511226..1512059 (-) 834 Protein_1408 cell division protein FtsK -
  PYW39_RS07350 rnjB 1512299..1513972 (-) 1674 WP_049414675.1 ribonuclease J2 -
  PYW39_RS07355 pnp 1514159..1516258 (-) 2100 WP_002466036.1 polyribonucleotide nucleotidyltransferase -
  PYW39_RS07360 rpsO 1516394..1516663 (-) 270 WP_002450539.1 30S ribosomal protein S15 -
  PYW39_RS07365 ribF 1516777..1517748 (-) 972 WP_002466033.1 riboflavin biosynthesis protein RibF -
  PYW39_RS07370 truB 1517761..1518678 (-) 918 WP_002466042.1 tRNA pseudouridine(55) synthase TruB -
  PYW39_RS07375 rbfA 1518831..1519181 (-) 351 WP_002466047.1 30S ribosome-binding factor RbfA -
  PYW39_RS07380 infB 1519321..1521486 (-) 2166 WP_015365072.1 translation initiation factor IF-2 -
  PYW39_RS07385 - 1521491..1521808 (-) 318 WP_002466040.1 L7Ae/L30e/S12e/Gadd45 family ribosomal protein -
  PYW39_RS07390 rnpM 1521805..1522092 (-) 288 WP_002450545.1 RNase P modulator RnpM -
  PYW39_RS07395 nusA 1522112..1523344 (-) 1233 WP_015365073.1 transcription termination factor NusA -
  PYW39_RS07400 rimP 1523365..1523832 (-) 468 WP_015365074.1 ribosome maturation factor RimP -
  PYW39_RS07405 - 1524015..1528325 (-) 4311 WP_103286318.1 PolC-type DNA polymerase III -
  PYW39_RS07410 - 1528593..1530296 (-) 1704 WP_049414683.1 proline--tRNA ligase -
  PYW39_RS07415 rseP 1530316..1531602 (-) 1287 WP_002466035.1 RIP metalloprotease RseP -
  PYW39_RS07420 - 1531845..1532627 (-) 783 WP_002466065.1 phosphatidate cytidylyltransferase -
  PYW39_RS07425 - 1532631..1533401 (-) 771 WP_002466060.1 isoprenyl transferase -
  PYW39_RS07430 frr 1533634..1534188 (-) 555 WP_002450553.1 ribosome recycling factor -
  PYW39_RS07435 pyrH 1534204..1534926 (-) 723 WP_002450554.1 UMP kinase -
  PYW39_RS07440 tsf 1535067..1535945 (-) 879 WP_049414688.1 translation elongation factor Ts -
  PYW39_RS07445 rpsB 1536097..1536885 (-) 789 WP_002466032.1 30S ribosomal protein S2 -
  PYW39_RS07450 codY 1537192..1537965 (-) 774 WP_002450557.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  PYW39_RS07455 hslU 1537989..1539392 (-) 1404 WP_015365077.1 ATP-dependent protease ATPase subunit HslU -
  PYW39_RS07460 hslV 1539481..1540026 (-) 546 WP_002450559.1 ATP-dependent protease subunit HslV -
  PYW39_RS07465 xerC 1540023..1540916 (-) 894 WP_103286312.1 tyrosine recombinase XerC -
  PYW39_RS07470 trmFO 1541081..1542388 (-) 1308 WP_103286313.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  PYW39_RS07475 topA 1542505..1544580 (-) 2076 WP_180991094.1 type I DNA topoisomerase -
  PYW39_RS07480 dprA 1544758..1545633 (-) 876 WP_373364739.1 DNA-processing protein DprA Machinery gene
  PYW39_RS07485 sucD 1545868..1546773 (-) 906 WP_002466045.1 succinate--CoA ligase subunit alpha -
  PYW39_RS07490 sucC 1546795..1547961 (-) 1167 WP_002466034.1 ADP-forming succinate--CoA ligase subunit beta -
  PYW39_RS07495 - 1548069..1548839 (-) 771 WP_002466053.1 ribonuclease HII -
  PYW39_RS07500 ylqF 1548832..1549707 (-) 876 WP_002466050.1 ribosome biogenesis GTPase YlqF -
  PYW39_RS07505 - 1550007..1552607 (+) 2601 WP_002466048.1 YfhO family protein -
  PYW39_RS07510 - 1552600..1555209 (+) 2610 WP_019235877.1 YfhO family protein -
  PYW39_RS07515 rplS 1555375..1555725 (-) 351 WP_002450570.1 50S ribosomal protein L19 -
  PYW39_RS07520 trmD 1555831..1556568 (-) 738 WP_002466037.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PYW39_RS07525 rimM 1556568..1557071 (-) 504 WP_002466057.1 ribosome maturation factor RimM -
  PYW39_RS07530 rpsP 1557239..1557514 (-) 276 WP_002466054.1 30S ribosomal protein S16 -
  PYW39_RS07535 ffh 1558046..1559413 (-) 1368 WP_002450574.1 signal recognition particle protein -
  PYW39_RS07540 - 1559438..1559770 (-) 333 WP_002466066.1 putative DNA-binding protein -
  PYW39_RS07545 ftsY 1559757..1561001 (-) 1245 WP_002466030.1 signal recognition particle-docking protein FtsY -
  PYW39_RS07550 smc 1560998..1564567 (-) 3570 WP_015365084.1 chromosome segregation protein SMC -
  PYW39_RS07555 rnc 1564720..1565448 (-) 729 WP_015365085.1 ribonuclease III -
  PYW39_RS07560 - 1565559..1565792 (-) 234 WP_001830184.1 acyl carrier protein -
  PYW39_RS07565 fabG 1566005..1566739 (-) 735 WP_015365086.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  PYW39_RS07570 fabD 1566739..1567659 (-) 921 WP_002466912.1 ACP S-malonyltransferase -
  PYW39_RS07575 plsX 1567652..1568638 (-) 987 WP_015365088.1 phosphate acyltransferase PlsX -
  PYW39_RS07580 fapR 1568631..1569200 (-) 570 WP_002466907.1 transcription factor FapR -
  PYW39_RS07585 recG 1569350..1571398 (-) 2049 WP_002466919.1 ATP-dependent DNA helicase RecG -

Sequence

Protein


Download         Length: 291 a.a.        Molecular weight: 33923.00 Da        Isoelectric Point: 8.6890

>NTDB_id=797018 PYW39_RS07480 WP_373364739.1 1544758..1545633(-) (dprA) [Staphylococcus warneri strain DSM 20316]
MNLNENFLPKLYWSHFTTSQIHQFYRYNPHIFQMTSNEQEISLLYWITQHHPTLLSKFHKYKQINIVEIMKILRQLHVKY
ITFFDEDYPYLLKEIYDYPFVLFYKGDKKLFLSNQTLAIVGARKCSNYTQEALQYLFPSFKEKNITIISGLAEGADSEAH
IQALKIDLSTIAVLGFGHHYYYPRNLVSLRKNIEEKGLVISEYPPFSPIAKYKFPERNRIISGLSKGVLLTESNERSGSR
ITVDCALEQNRNVYVLPGKLFDSKTKGNLLLHQEGASMVVSAEDILQDYLN

Nucleotide


Download         Length: 876 bp        

>NTDB_id=797018 PYW39_RS07480 WP_373364739.1 1544758..1545633(-) (dprA) [Staphylococcus warneri strain DSM 20316]
ATGAATTTGAACGAAAACTTTTTACCTAAATTATACTGGTCACATTTTACAACCTCACAAATCCATCAATTTTATCGGTA
CAACCCTCATATTTTCCAAATGACTTCTAATGAACAAGAAATTTCATTATTATATTGGATTACTCAACATCATCCTACGC
TTTTATCAAAATTTCATAAATATAAACAAATAAATATAGTAGAAATTATGAAAATTCTTCGACAATTACATGTAAAATAT
ATCACTTTTTTCGACGAAGATTATCCTTATTTATTAAAAGAAATCTATGATTATCCATTTGTTCTATTTTATAAGGGAGA
TAAGAAATTATTTTTAAGTAATCAAACTTTGGCAATTGTTGGTGCTAGGAAATGTTCAAATTATACGCAAGAAGCACTAC
AATATCTTTTTCCTTCATTTAAAGAAAAAAATATTACGATTATTTCTGGGTTAGCAGAAGGTGCCGATAGTGAAGCACAC
ATACAAGCCTTGAAAATCGATTTATCAACCATTGCAGTATTAGGGTTTGGTCACCATTATTATTATCCTAGAAACTTAGT
TTCATTAAGAAAAAATATTGAAGAAAAGGGGTTAGTTATTTCGGAGTACCCACCATTTTCGCCAATTGCTAAGTATAAGT
TTCCAGAAAGAAATAGGATTATTAGTGGATTATCAAAAGGTGTATTATTAACTGAATCAAATGAAAGAAGTGGTAGCAGA
ATCACAGTTGATTGTGCATTAGAACAAAATAGAAATGTGTATGTTTTACCGGGTAAATTATTTGATTCAAAAACAAAAGG
AAATCTATTATTGCATCAAGAAGGAGCTTCTATGGTCGTTAGTGCTGAAGACATTTTACAAGACTATTTAAATTGA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(74-280)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

55.634

97.595

0.543
  dprA Staphylococcus aureus MW2

55.634

97.595

0.543