Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PXG99_RS01305 Genome accession   NZ_CP118911
Coordinates   242804..242977 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain XRD006     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 237804..247977
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PXG99_RS01255 (PXG99_01255) comGD 237923..238360 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  PXG99_RS01260 (PXG99_01260) comGE 238344..238658 (+) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  PXG99_RS01265 (PXG99_01265) comGF 238603..239067 (+) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  PXG99_RS01270 (PXG99_01270) comGG 239068..239445 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  PXG99_RS01275 (PXG99_01275) - 239502..239681 (+) 180 WP_003153093.1 YqzE family protein -
  PXG99_RS01280 (PXG99_01280) - 239722..240051 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PXG99_RS01285 (PXG99_01285) tapA 240310..240981 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PXG99_RS01290 (PXG99_01290) - 240953..241537 (+) 585 WP_012117977.1 signal peptidase I -
  PXG99_RS01295 (PXG99_01295) - 241602..242387 (+) 786 WP_007408329.1 TasA family protein -
  PXG99_RS01300 (PXG99_01300) sinR 242435..242770 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PXG99_RS01305 (PXG99_01305) sinI 242804..242977 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PXG99_RS01310 (PXG99_01310) - 243154..243948 (-) 795 WP_014418368.1 YqhG family protein -
  PXG99_RS01315 (PXG99_01315) - 243970..245640 (-) 1671 WP_021494309.1 SNF2-related protein -
  PXG99_RS01320 (PXG99_01320) gcvT 246064..247164 (+) 1101 WP_029973877.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=796222 PXG99_RS01305 WP_014418369.1 242804..242977(-) (sinI) [Bacillus velezensis strain XRD006]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=796222 PXG99_RS01305 WP_014418369.1 242804..242977(-) (sinI) [Bacillus velezensis strain XRD006]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719