Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   PXG99_RS01270 Genome accession   NZ_CP118911
Coordinates   239068..239445 (+) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain XRD006     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 234068..244445
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PXG99_RS01235 (PXG99_01235) - 234383..235333 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  PXG99_RS01240 (PXG99_01240) comGA 235526..236596 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  PXG99_RS01245 (PXG99_01245) comGB 236583..237620 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  PXG99_RS01250 (PXG99_01250) comGC 237625..237933 (+) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  PXG99_RS01255 (PXG99_01255) comGD 237923..238360 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  PXG99_RS01260 (PXG99_01260) comGE 238344..238658 (+) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  PXG99_RS01265 (PXG99_01265) comGF 238603..239067 (+) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  PXG99_RS01270 (PXG99_01270) comGG 239068..239445 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  PXG99_RS01275 (PXG99_01275) - 239502..239681 (+) 180 WP_003153093.1 YqzE family protein -
  PXG99_RS01280 (PXG99_01280) - 239722..240051 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PXG99_RS01285 (PXG99_01285) tapA 240310..240981 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PXG99_RS01290 (PXG99_01290) - 240953..241537 (+) 585 WP_012117977.1 signal peptidase I -
  PXG99_RS01295 (PXG99_01295) - 241602..242387 (+) 786 WP_007408329.1 TasA family protein -
  PXG99_RS01300 (PXG99_01300) sinR 242435..242770 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PXG99_RS01305 (PXG99_01305) sinI 242804..242977 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PXG99_RS01310 (PXG99_01310) - 243154..243948 (-) 795 WP_014418368.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=796220 PXG99_RS01270 WP_017418138.1 239068..239445(+) (comGG) [Bacillus velezensis strain XRD006]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=796220 PXG99_RS01270 WP_017418138.1 239068..239445(+) (comGG) [Bacillus velezensis strain XRD006]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512