Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   PYH56_RS09040 Genome accession   NZ_CP118820
Coordinates   1896829..1897404 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 7057     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1852566..1896428 1896829..1897404 flank 401


Gene organization within MGE regions


Location: 1852566..1897404
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYH56_RS08675 (PYH56_08675) - 1852566..1853969 (-) 1404 WP_282895669.1 N-acetylmuramoyl-L-alanine amidase -
  PYH56_RS08680 (PYH56_08680) - 1853969..1854238 (-) 270 WP_002456916.1 phage holin -
  PYH56_RS08685 (PYH56_08685) - 1854293..1854820 (-) 528 WP_282895670.1 hypothetical protein -
  PYH56_RS08690 (PYH56_08690) - 1854820..1855329 (-) 510 WP_282895671.1 hypothetical protein -
  PYH56_RS08695 (PYH56_08695) - 1855382..1857187 (-) 1806 Protein_1678 glucosaminidase domain-containing protein -
  PYH56_RS08700 (PYH56_08700) - 1857298..1858068 (-) 771 WP_282895672.1 AP2 domain-containing protein -
  PYH56_RS08705 (PYH56_08705) - 1858366..1858767 (-) 402 WP_248114786.1 hypothetical protein -
  PYH56_RS08710 (PYH56_08710) - 1858751..1859125 (-) 375 WP_282895964.1 hypothetical protein -
  PYH56_RS08715 (PYH56_08715) - 1859208..1859348 (-) 141 WP_001830255.1 XkdX family protein -
  PYH56_RS08720 (PYH56_08720) - 1859350..1859688 (-) 339 WP_002486362.1 hypothetical protein -
  PYH56_RS08725 (PYH56_08725) - 1859693..1861225 (-) 1533 WP_282895673.1 BppU family phage baseplate upper protein -
  PYH56_RS08730 (PYH56_08730) - 1861225..1863891 (-) 2667 WP_282895674.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  PYH56_RS08735 (PYH56_08735) - 1863906..1865762 (-) 1857 WP_282895675.1 SGNH/GDSL hydrolase family protein -
  PYH56_RS08740 (PYH56_08740) - 1865776..1866714 (-) 939 WP_282895676.1 phage tail domain-containing protein -
  PYH56_RS08745 (PYH56_08745) - 1866730..1869834 (-) 3105 WP_282895677.1 terminase -
  PYH56_RS08750 (PYH56_08750) - 1869837..1870139 (-) 303 WP_047499986.1 hypothetical protein -
  PYH56_RS08755 (PYH56_08755) - 1870202..1870696 (-) 495 WP_282895678.1 tail assembly chaperone -
  PYH56_RS08760 (PYH56_08760) - 1870758..1871297 (-) 540 WP_282895680.1 phage tail protein -
  PYH56_RS08765 (PYH56_08765) - 1871284..1871721 (-) 438 WP_046026328.1 DUF3168 domain-containing protein -
  PYH56_RS08770 (PYH56_08770) - 1871734..1872147 (-) 414 WP_282895682.1 HK97-gp10 family putative phage morphogenesis protein -
  PYH56_RS08775 (PYH56_08775) - 1872140..1872469 (-) 330 WP_282895684.1 phage head closure protein -
  PYH56_RS08780 (PYH56_08780) - 1872462..1872776 (-) 315 WP_237615250.1 phage head-tail connector protein -
  PYH56_RS08785 (PYH56_08785) - 1872776..1873066 (-) 291 WP_070653512.1 Rho termination factor N-terminal domain-containing protein -
  PYH56_RS08790 (PYH56_08790) - 1873083..1874039 (-) 957 WP_282895686.1 sugar-binding protein -
  PYH56_RS08795 (PYH56_08795) - 1874054..1874578 (-) 525 WP_282895688.1 phage scaffolding protein -
  PYH56_RS08800 (PYH56_08800) - 1874692..1874892 (-) 201 WP_282895691.1 hypothetical protein -
  PYH56_RS08805 (PYH56_08805) - 1874895..1875848 (-) 954 WP_282895694.1 phage head morphogenesis protein -
  PYH56_RS08810 (PYH56_08810) - 1875805..1877241 (-) 1437 WP_282895695.1 phage portal protein -
  PYH56_RS08815 (PYH56_08815) - 1877247..1878512 (-) 1266 WP_282895697.1 PBSX family phage terminase large subunit -
  PYH56_RS08820 (PYH56_08820) - 1878496..1878876 (-) 381 WP_282895699.1 DNA-binding protein -
  PYH56_RS08825 (PYH56_08825) - 1879395..1879811 (-) 417 WP_001830279.1 hypothetical protein -
  PYH56_RS08830 (PYH56_08830) - 1879811..1880263 (-) 453 WP_282895700.1 hypothetical protein -
  PYH56_RS08835 (PYH56_08835) - 1880284..1880502 (-) 219 WP_282895701.1 hypothetical protein -
  PYH56_RS08840 (PYH56_08840) - 1880506..1880646 (-) 141 WP_282895702.1 hypothetical protein -
  PYH56_RS08845 (PYH56_08845) - 1880853..1881023 (-) 171 WP_282895703.1 transcriptional regulator -
  PYH56_RS08850 (PYH56_08850) - 1881016..1881168 (-) 153 WP_233931993.1 DUF1381 domain-containing protein -
  PYH56_RS08855 (PYH56_08855) dut 1881205..1881630 (-) 426 WP_282895704.1 dUTP diphosphatase -
  PYH56_RS08860 (PYH56_08860) - 1881631..1881834 (-) 204 WP_237614951.1 hypothetical protein -
  PYH56_RS08865 (PYH56_08865) - 1881821..1882054 (-) 234 WP_282895705.1 hypothetical protein -
  PYH56_RS08870 (PYH56_08870) - 1882071..1882601 (-) 531 WP_048668098.1 NUMOD4 domain-containing protein -
  PYH56_RS08875 (PYH56_08875) - 1882602..1882958 (-) 357 WP_282895706.1 thermonuclease family protein -
  PYH56_RS08880 (PYH56_08880) - 1882946..1883131 (-) 186 WP_282895707.1 hypothetical protein -
  PYH56_RS08885 (PYH56_08885) - 1883128..1883808 (-) 681 WP_282895708.1 hypothetical protein -
  PYH56_RS08890 (PYH56_08890) - 1883811..1884266 (-) 456 WP_282895709.1 DUF3310 domain-containing protein -
  PYH56_RS08895 (PYH56_08895) - 1884263..1884676 (-) 414 WP_282895711.1 SA1788 family PVL leukocidin-associated protein -
  PYH56_RS08900 (PYH56_08900) - 1884677..1884868 (-) 192 WP_089424063.1 hypothetical protein -
  PYH56_RS08905 (PYH56_08905) - 1884869..1885276 (-) 408 WP_282895716.1 RusA family crossover junction endodeoxyribonuclease -
  PYH56_RS08910 (PYH56_08910) - 1885286..1885531 (-) 246 WP_002497109.1 hypothetical protein -
  PYH56_RS08915 (PYH56_08915) - 1885531..1885692 (-) 162 WP_213482782.1 hypothetical protein -
  PYH56_RS08920 (PYH56_08920) - 1885686..1886456 (-) 771 WP_282895718.1 ATP-binding protein -
  PYH56_RS08925 (PYH56_08925) - 1886467..1887231 (-) 765 WP_282895965.1 conserved phage C-terminal domain-containing protein -
  PYH56_RS08930 (PYH56_08930) - 1887218..1887433 (-) 216 WP_282895720.1 helix-turn-helix transcriptional regulator -
  PYH56_RS08935 (PYH56_08935) - 1887439..1887648 (-) 210 WP_282895721.1 helix-turn-helix transcriptional regulator -
  PYH56_RS08940 (PYH56_08940) - 1887673..1888308 (-) 636 WP_282895723.1 NUMOD4 domain-containing protein -
  PYH56_RS08945 (PYH56_08945) - 1888309..1888974 (-) 666 WP_282895967.1 putative HNHc nuclease -
  PYH56_RS08950 (PYH56_08950) - 1888961..1889233 (-) 273 WP_282895725.1 hypothetical protein -
  PYH56_RS08955 (PYH56_08955) - 1889246..1889656 (-) 411 WP_237628634.1 single-stranded DNA-binding protein -
  PYH56_RS08960 (PYH56_08960) - 1889656..1890303 (-) 648 WP_002495407.1 ERF family protein -
  PYH56_RS08965 (PYH56_08965) - 1890296..1890523 (-) 228 WP_282895727.1 DUF2483 family protein -
  PYH56_RS08970 (PYH56_08970) - 1890495..1890767 (-) 273 WP_282895728.1 hypothetical protein -
  PYH56_RS08975 (PYH56_08975) - 1890829..1891005 (-) 177 WP_203085080.1 hypothetical protein -
  PYH56_RS08980 (PYH56_08980) - 1891170..1891403 (+) 234 WP_282895729.1 hypothetical protein -
  PYH56_RS08985 (PYH56_08985) - 1891514..1891723 (-) 210 WP_001830281.1 hypothetical protein -
  PYH56_RS08990 (PYH56_08990) - 1891736..1892476 (-) 741 WP_282895730.1 BRO family protein -
  PYH56_RS08995 (PYH56_08995) - 1892527..1892697 (+) 171 WP_237642849.1 hypothetical protein -
  PYH56_RS09000 (PYH56_09000) - 1892658..1892819 (-) 162 WP_282895731.1 hypothetical protein -
  PYH56_RS09005 (PYH56_09005) - 1892832..1893278 (-) 447 WP_282895732.1 hypothetical protein -
  PYH56_RS09010 (PYH56_09010) - 1893303..1893530 (-) 228 WP_099816465.1 BetR domain protein -
  PYH56_RS09015 (PYH56_09015) - 1893702..1894313 (+) 612 WP_282895733.1 S24 family peptidase -
  PYH56_RS09020 (PYH56_09020) - 1894369..1895316 (+) 948 WP_282895734.1 DUF5067 domain-containing protein -
  PYH56_RS09025 (PYH56_09025) - 1895379..1896428 (+) 1050 WP_282895735.1 site-specific integrase -
  PYH56_RS09040 (PYH56_09040) comK/comK1 1896829..1897404 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=795609 PYH56_RS09040 WP_001829272.1 1896829..1897404(-) (comK/comK1) [Staphylococcus epidermidis strain 7057]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=795609 PYH56_RS09040 WP_001829272.1 1896829..1897404(-) (comK/comK1) [Staphylococcus epidermidis strain 7057]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
GACAAATGGTACTGAGATTATCAGATTTGATCAAACCCGAAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAGTTTTATGGCAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATTTCTAGTAAACCACCT
ATTTTACTTACACCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCGGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCTTTAACACTCA
ATGTATCATTTCATAGTTTGTGGCATCAATACACCAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCTATTGACTATAATCAGTCCTCCTTAAATATTTTCGAGGCGCTTTCACGCTACTCTCT
TTTTGAAGAAAATTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(7-158)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743
  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743